Property Summary

NCBI Gene PubMed Count 123
PubMed Score 301.20
PubTator Score 206.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.39247161186086E-10
lung adenocarcinoma 2714 2.16619117419284E-8
tuberculosis 1563 6.38696732467316E-8
malignant mesothelioma 3163 4.19258242102542E-6
lung cancer 4473 5.21308705733377E-6
pilocytic astrocytoma 3086 2.15164113435359E-4
Down syndrome 548 2.48267875923286E-4
dermatomyositis 967 2.88688741186773E-4
invasive ductal carcinoma 2950 3.84626073199815E-4
Breast cancer 3099 4.53085341565124E-4
acute quadriplegic myopathy 1157 4.57341078497265E-4
medulloblastoma, large-cell 6234 5.3260765871178E-4
ovarian cancer 8492 8.38684693357697E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00257989987038563
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00266412416534329
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00278001018350946
pancreatic cancer 2300 0.00329036622959963
cystic fibrosis 1670 0.00443913434348376
cutaneous lupus erythematosus 1056 0.00596355871813449
adrenocortical carcinoma 1427 0.00742843006657947
osteosarcoma 7933 0.00832183982877697
active Crohn's disease 918 0.0138649816265635
COPD 116 0.0226819687757239
Endometriosis 535 0.0472389624463286

Expression

  Differential Expression (24)

Synonym

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (102)

PMID Text
27239842 This review focuses on the role of ABC transporters A1 and G1 in the pathogenesis of atherosclerosis
26757251 Our results indicated that genetic variants of ABCG1 may be predictors of survival of nonsmall-cell lung cancer patients
26695502 Leu at position 550/562 in mABCG1/hABCG1 is critical for their plasma membrane localization but not for ABCG1-mediated cholesterol efflux.
26296893 HUWE1 and NEDD4-1 are two E3 ligases that are fundamental enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity
26253613 Data suggest that ligand-induced activation of RAGE (advanced glycosylation end product-specific receptor) down-regulates ABCG1-mediated cholesterol efflux from macrophages leading to diabetic angiopathies and atherosclerotic plaques.
26051418 Hyperalphalipoproteinemics present a decrease in hsa-miR-33a and higher mRNA expression of ABCA1 and ABCG1.
25890853 ABCG1 polymorphisms are associated with reduced risk of developing ischemic stroke in hypertriglyceridemic population and atherothrombotic stroke in this cohort of Chinese Han population.
25732853 ABCG1 can interact with cholesterol via a functional CRAC domain (cholesterol recognition/interaction amino acid consensus motifs).
25616132 RIP140 negatively regulated the macrophage expression of ATP-binding cassette transporters A1 and G1.
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPARgamma/LXRalpha pathway in THP-1 macrophage-derived foam cells.
More...

AA Sequence

MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLP      1 - 70
RRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMK     71 - 140
GAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEILTALGLLSCA    141 - 210
NTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKL    211 - 280
FELFDQLYVLSQGQCVYRGKVCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCD    281 - 350
SDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS    351 - 420
VLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLN    421 - 490
YWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAALGTMTSLVAQSLGLLIGAAST    491 - 560
SLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIDETCH    561 - 630
FQKSEAILRELDVENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRAER                          631 - 678
//

Text Mined References (124)

PMID Year Title
27239842 [Role of the ABC transporters A1 and G1, key reverse cholesterol transport proteins, in atherosclerosis].
26757251 2016 Genetic variants in ABCG1 are associated with survival of nonsmall-cell lung cancer patients.
26695502 2016 Identification of an Amino Acid Residue Critical for Plasma Membrane Localization of ATP-Binding Cassette Transporter G1--Brief Report.
26296893 2015 The E3 ubiquitin ligases, HUWE1 and NEDD4-1, are involved in the post-translational regulation of the ABCG1 and ABCG4 lipid transporters.
26253613 2015 RAGE Suppresses ABCG1-Mediated Macrophage Cholesterol Efflux in Diabetes.
26051418 2015 Asymptomatic individuals with high HDL-C levels overexpress ABCA1 and ABCG1 and present miR-33a dysregulation in peripheral blood mononuclear cells.
25890853 2015 Association of ATP-Binding Cassette Transporter G1 Polymorphisms with Risk of Ischemic Stroke in the Chinese Han Population.
25732853 2015 Cholesterol sensing by the ABCG1 lipid transporter: Requirement of a CRAC motif in the final transmembrane domain.
25616132 2015 RIP140 triggers foam-cell formation by repressing ABCA1/G1 expression and cholesterol efflux via liver X receptor.
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPAR?/LXR? signaling pathway in THP-1 macrophage-derived foam cells.
More...