Property Summary

NCBI Gene PubMed Count 123
Grant Count 185
R01 Count 84
Funding $28,999,996.62
PubMed Score 301.20
PubTator Score 206.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Gene

Gene RIF (102)

PMID Text
27239842 This review focuses on the role of ABC transporters A1 and G1 in the pathogenesis of atherosclerosis
26757251 Our results indicated that genetic variants of ABCG1 may be predictors of survival of nonsmall-cell lung cancer patients
26695502 Leu at position 550/562 in mABCG1/hABCG1 is critical for their plasma membrane localization but not for ABCG1-mediated cholesterol efflux.
26296893 HUWE1 and NEDD4-1 are two E3 ligases that are fundamental enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity
26253613 Data suggest that ligand-induced activation of RAGE (advanced glycosylation end product-specific receptor) down-regulates ABCG1-mediated cholesterol efflux from macrophages leading to diabetic angiopathies and atherosclerotic plaques.
26051418 Hyperalphalipoproteinemics present a decrease in hsa-miR-33a and higher mRNA expression of ABCA1 and ABCG1.
25890853 ABCG1 polymorphisms are associated with reduced risk of developing ischemic stroke in hypertriglyceridemic population and atherothrombotic stroke in this cohort of Chinese Han population.
25732853 ABCG1 can interact with cholesterol via a functional CRAC domain (cholesterol recognition/interaction amino acid consensus motifs).
25616132 RIP140 negatively regulated the macrophage expression of ATP-binding cassette transporters A1 and G1.
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPARgamma/LXRalpha pathway in THP-1 macrophage-derived foam cells.
More...

AA Sequence

MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLP      1 - 70
RRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMK     71 - 140
GAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEILTALGLLSCA    141 - 210
NTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKL    211 - 280
FELFDQLYVLSQGQCVYRGKVCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCD    281 - 350
SDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS    351 - 420
VLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLN    421 - 490
YWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAALGTMTSLVAQSLGLLIGAAST    491 - 560
SLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIDETCH    561 - 630
FQKSEAILRELDVENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRAER                          631 - 678
//

Text Mined References (124)

PMID Year Title
27239842 [Role of the ABC transporters A1 and G1, key reverse cholesterol transport proteins, in atherosclerosis].
26757251 2016 Genetic variants in ABCG1 are associated with survival of nonsmall-cell lung cancer patients.
26695502 2016 Identification of an Amino Acid Residue Critical for Plasma Membrane Localization of ATP-Binding Cassette Transporter G1--Brief Report.
26296893 2015 The E3 ubiquitin ligases, HUWE1 and NEDD4-1, are involved in the post-translational regulation of the ABCG1 and ABCG4 lipid transporters.
26253613 2015 RAGE Suppresses ABCG1-Mediated Macrophage Cholesterol Efflux in Diabetes.
26051418 2015 Asymptomatic individuals with high HDL-C levels overexpress ABCA1 and ABCG1 and present miR-33a dysregulation in peripheral blood mononuclear cells.
25890853 2015 Association of ATP-Binding Cassette Transporter G1 Polymorphisms with Risk of Ischemic Stroke in the Chinese Han Population.
25732853 2015 Cholesterol sensing by the ABCG1 lipid transporter: Requirement of a CRAC motif in the final transmembrane domain.
25616132 2015 RIP140 triggers foam-cell formation by repressing ABCA1/G1 expression and cholesterol efflux via liver X receptor.
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPAR?/LXR? signaling pathway in THP-1 macrophage-derived foam cells.
More...