Property Summary

NCBI Gene PubMed Count 134
PubMed Score 319.95
PubTator Score 206.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.087 1.4e-02
acute quadriplegic myopathy 1.237 4.6e-04
adrenocortical carcinoma -1.931 7.4e-03
Astrocytoma, Pilocytic 1.200 2.2e-04
Breast cancer 1.200 4.5e-04
COPD -1.100 2.3e-02
cutaneous lupus erythematosus 1.100 6.0e-03
cystic fibrosis -1.200 4.4e-03
dermatomyositis 1.900 2.9e-04
Down syndrome 1.600 2.5e-04
Endometriosis -1.430 4.7e-02
intraductal papillary-mucinous adenoma (... 2.200 2.6e-03
intraductal papillary-mucinous carcinoma... 2.600 2.7e-03
intraductal papillary-mucinous neoplasm ... 3.500 2.8e-03
invasive ductal carcinoma 1.384 3.8e-04
juvenile dermatomyositis 1.563 1.4e-10
lung adenocarcinoma -1.400 2.2e-08
lung cancer -3.400 5.2e-06
malignant mesothelioma -1.200 4.2e-06
medulloblastoma, large-cell -1.800 5.3e-04
osteosarcoma -1.785 8.3e-03
ovarian cancer 2.200 8.4e-04
pancreatic cancer 1.100 3.3e-03
tuberculosis -3.100 6.4e-08

Gene RIF (113)

AA Sequence

MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLP      1 - 70
RRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMK     71 - 140
GAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEILTALGLLSCA    141 - 210
NTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKL    211 - 280
FELFDQLYVLSQGQCVYRGKVCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCD    281 - 350
SDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS    351 - 420
VLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLN    421 - 490
YWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAALGTMTSLVAQSLGLLIGAAST    491 - 560
SLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIDETCH    561 - 630
FQKSEAILRELDVENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRAER                          631 - 678
//

Text Mined References (135)

PMID Year Title