Property Summary

Ligand Count 2,029
NCBI Gene PubMed Count 287
PubMed Score 1243.82
PubTator Score 649.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (9)

Disease log2 FC p
periodontitis 1.100 4.0e-10
Breast cancer 1.500 5.4e-05
colon cancer 1.100 4.1e-02
cutaneous lupus erythematosus 1.700 4.6e-02
head and neck cancer 1.300 2.1e-02
head and neck cancer and chronic obstruc... 1.300 1.2e-02
invasive ductal carcinoma 1.222 3.3e-02
lung adenocarcinoma 1.500 5.8e-05
non-small cell lung cancer 1.825 1.9e-07

 CSPA Cell Line (3)

Gene RIF (270)

AA Sequence

MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLRE      1 - 70
MQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKK     71 - 140
AFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSS    141 - 210
SKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKT    211 - 280
PDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFR    281 - 350
GRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI    351 - 420
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC                       421 - 471
//

Text Mined References (301)

PMID Year Title