Property Summary

NCBI Gene PubMed Count 259
Grant Count 375
R01 Count 282
Funding $27,823,983.36
PubMed Score 1132.95
PubTator Score 649.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 0.046
periodontitis 1.100 0.000
non-small cell lung cancer 1.825 0.000
colon cancer 1.100 0.041
lung adenocarcinoma 1.700 0.000
invasive ductal carcinoma 1.222 0.033
Breast cancer 1.500 0.000
head and neck cancer 1.300 0.021
head and neck cancer and chronic obstruc... 1.300 0.012

Synonym

Accession P45452 A8K846 B2RCZ3 Q6NWN6
Symbols CLG3
MDST
MANDP1
MMP-13

Gene

PDB

1EUB   1FLS   1FM1   1PEX   1UC1   1XUC   1XUD   1XUR   1YOU   1ZTQ   2D1N   2E2D   2OW9   2OZR   2PJT   2YIG   3ELM   3I7G   3I7I   3KEC   3KEJ   3KEK   3KRY   3LJZ   3O2X   3TVC   3WV1   3WV2   3WV3   3ZXH   456C   4A7B   4FU4   4FVL   4G0D   4JP4   4JPA   4L19   5BOT   5BOY   5BPA   830C  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
570 screening 46 / 0 / 64879 Primary biochemical high-throughput screening assay for inhibitors of Matrix Metalloproteinase 13 (MMP13) activity
734 screening 8 / 0 / 5141 Assay to identify inhibitors among the possible fluorescent artifacts from the primary HTS inhibition assay of Matrix Metalloproteinase 13 (MMP13) activity
735 confirmatory 15 / 0 / 27 Dose-response biochemical assay for inhibitors of Matrix Metalloproteinase 13 (MMP13) activity
769 confirmatory 4 / 0 / 4 Dose response biochemical assay for autofluorescent inhibitors of Matrix Metalloproteinase 13 (MMP13) activity
1931 summary 2 / 0 / 0 Summary of probe development efforts to identify inhibitors of Matrix Metalloproteinase-13 (MMP-13)
2067 screening 9 / 0 / 0 Late stage results from the probe development efforts to identify inhibitors of Matrix Metalloproteinase-13 (MMP-13).

Gene RIF (242)

PMID Text
26934732 Hyaluronic acid exhibits a pronounced suppressive effect on MMP-13 expression in osteoarthritis.
26474296 IL-1Ra is associated with MMP-13 expression and has a novel function in such regulation without interference of the IL-1 signaling cascade.
26447617 Report modified platelet deposition on matrix metalloproteinase 13 digested collagen I
26395178 Data show that the expression of transforming growth factor beta 1 (TGFB1) was correlated with the expression of SMA- and MAD-related protein 3 (SMAD3) and matrix metalloproteinase-13 (MMP13) in osteoarthritis (OA)-affected cartilage.
26378022 GP73 enhances MMP-13 expression through cAMP responsive element binding protein (CREB)-mediated transcription activation. Levels of GP73 and MMP-13 are increased and positively correlated in human HCC tissues. Augmented MMP-13 potentiates HCC cell metastasis.
26369384 SENP2 inhibits MMP13 expression in BC cells through de-SUMOylation of TBL1/TBLR1, which inhibits nuclear translocation of beta-catenin.
26362844 siRNA inhibited the effect of MMP13-containing exosomes on tumor cells metastasis as well as angiogenesis
26308852 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13
26305549 Data show that blocking the interleukin-8 (IL-8)/androgen receptor (AR)/matrix metalloproteinases (MMPs) signals partially reversed the infiltrating B cells capacity to increase the bladder cancer (BCa) cell invasion.
26305372 together, these data demonstrate that SERPINE2 might prevent cartilage catabolism by inhibiting the expression of MMP-13, one of the most relevant collagenases, involved in cartilage breakdown in OA.
More...

AA Sequence

MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLRE      1 - 70
MQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKK     71 - 140
AFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSS    141 - 210
SKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKT    211 - 280
PDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFR    281 - 350
GRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI    351 - 420
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC                       421 - 471
//

Text Mined References (273)

PMID Year Title
26934732 2016 Hyaluronic Acid Suppresses the Expression of Metalloproteinases in Osteoarthritic Cartilage Stimulated Simultaneously by Interleukin 1? and Mechanical Load.
26474296 2015 Interleukin-1 Receptor Antagonist Has a Novel Function in the Regulation of Matrix Metalloproteinase-13 Expression.
26447617 2015 Modified platelet deposition on matrix metalloproteinase 13 digested collagen I.
26395178 2015 Overexpression of MMP13 in human osteoarthritic cartilage is associated with the SMAD-independent TGF-? signalling pathway.
26378022 2015 Golgi protein 73 activation of MMP-13 promotes hepatocellular carcinoma cell invasion.
26369384 2015 SENP2 regulates MMP13 expression in a bladder cancer cell line through SUMOylation of TBL1/TBLR1.
26362844 2015 Matrix metalloproteinase 13-containing exosomes promote nasopharyngeal carcinoma metastasis.
26308852 2015 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13.
26305549 2015 Tumor microenvironment B cells increase bladder cancer metastasis via modulation of the IL-8/androgen receptor (AR)/MMPs signals.
26305372 2015 SERPINE2 Inhibits IL-1?-Induced MMP-13 Expression in Human Chondrocytes: Involvement of ERK/NF-?B/AP-1 Pathways.
More...