Property Summary

NCBI Gene PubMed Count 361
PubMed Score 1554.25
PubTator Score 2669.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Restrictive cardiomyopathy 11 0.0 5.0

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 4.3e-04
Duchenne muscular dystrophy 1.521 5.8e-09
glioblastoma -1.100 3.3e-04
limb girdle muscular dystrophy 2B 1.063 5.4e-04
lung cancer -1.300 2.3e-04
malignant mesothelioma 1.600 1.6e-05
psoriasis -2.300 7.0e-04

Protein-protein Interaction (4)

Gene RIF (310)

AA Sequence

MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPM      1 - 70
EESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERR     71 - 140
RAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQTERKSGK    141 - 210
RQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRIND    211 - 280
NQKVSKTRGKAKVTGRWK                                                        281 - 298
//

Text Mined References (362)

PMID Year Title