Property Summary

NCBI Gene PubMed Count 322
Grant Count 192
R01 Count 129
Funding $23,846,135.2
PubMed Score 1458.02
PubTator Score 2669.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis -2.300 0.001
glioblastoma -1.100 0.000
Duchenne muscular dystrophy 1.521 0.000
limb girdle muscular dystrophy 2B 1.063 0.001
lung cancer -1.300 0.000
adult high grade glioma -1.300 0.000

Synonym

Accession P45379 A2TDB9 A8K3K6 O60214 Q99596 Q99597 Q9BUF6 Q9UM96 TnTc
Symbols CMH2
RCM3
TnTC
cTnT
CMD1D
CMPD2
LVNC6

Gene

PDB

1J1D   1J1E   4Y99  

Gene RIF (272)

PMID Text
26984277 Data indicate that cardiac troponin T (cTn) timing was comparable between the urban university maximum care and the rural regional primary care facility.
26933082 In patients with acute ischemic stroke, troponin T levels were elevated compared to controls.
26868212 In patients with stable angina, the presence and extent of coronary atherosclerosis is related with circulating levels of hs-cTnT, also in the absence of ischemia, suggesting an ischemia-independent mechanism of hs-cTnT release.
26823030 Data show that high-sensitivity cardiac troponin T (hs-cTnT) was detected in 244 (87.1%) type 2 diabetes mellitus patients.
26782442 since hs-cTnT levels of non-AMI patients can be over the diagnostic cut-off value, further studies are necessary to define clinically applicable cut-off values of hs-cTnT
26774798 Three homologous genes have evolved in vertebrates to encode three muscle type-specific TnT isoforms: TNNT1 for slow skeletal muscle TnT, TNNT2 for cardiac muscle TnT, and TNNT3 for fast skeletal muscle TnT.
26720305 sensitivity and specificity of cardiac specific troponin T levels in detecting cardiac damage are much higher according to telecardiography and electrocardiography
26655552 Troponin T velocity can be used for early risk stratification of patients with increased risk for cardiac mortality.
26648730 Elevations in baseline hscTnT levels are suggestive of risk of developing cardiac complications from doxorubicin based chemotherapy.
26539512 the hsTnT levels detected here paralleled those of CK-MB and a cut-off level of 3466 ng/L could be diagnostic of Perioperative myocardial infarction .
More...

AA Sequence

MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPM      1 - 70
EESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERR     71 - 140
RAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQTERKSGK    141 - 210
RQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRIND    211 - 280
NQKVSKTRGKAKVTGRWK                                                        281 - 298
//

Text Mined References (323)

PMID Year Title
26984277 2016 How rapid is rapid? Exemplary results of real-life rapid rule-out troponin timing in troponin-positive acute coronary syndromes without persistent ST-segment elevation in two contrasting German chest pain unit facilities.
26933082 2016 Coronary Angiographic Findings in Acute Ischemic Stroke Patients With Elevated Cardiac Troponin: The Troponin Elevation in Acute Ischemic Stroke (TRELAS) Study.
26868212 2016 Effect of Coronary Atherosclerosis and Myocardial Ischemia on Plasma Levels of High-Sensitivity Troponin T and NT-proBNP in Patients With Stable Angina.
26823030 2015 Factors Associated with High-sensitivity Cardiac Troponin T in Patients with Type 2 Diabetes Mellitus.
26782442 2015 Clinical application of high-sensitivity cardiac troponin T test in acute myocardial infarction diagnosis.
26774798 2016 TNNT1, TNNT2, and TNNT3: Isoform genes, regulation, and structure-function relationships.
26720305 2016 The Diagnostic Value of Troponin T Level in the Determination of Cardiac Damage in Perinatal Asphyxia Newborns.
26655552 2016 The predictive value of high sensitivity-troponin velocity within the first 6h of presentation for cardiac outcomes regardless of acute coronary syndrome diagnosis.
26648730 2015 Utility of high-sensitivity cardiac troponin T in patients receiving anthracycline chemotherapy.
26539512 2015 Kinetics of Highly Sensitive Troponin T after Cardiac Surgery.
More...