Property Summary

NCBI Gene PubMed Count 33
PubMed Score 33.67
PubTator Score 18.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Distal arthrogryposis type 2B 4 0.0 0.0
Disease Target Count P-value
psoriasis 6694 6.8e-61
fibroadenoma 559 9.3e-03
diabetes mellitus 1728 1.6e-02
breast carcinoma 1638 2.6e-02
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.9
Disease Target Count Z-score Confidence
Distal arthrogryposis 42 6.693 3.3

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.100 2.6e-02
diabetes mellitus -1.100 1.6e-02
fibroadenoma -1.700 9.3e-03
psoriasis -2.300 6.8e-61

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (11)

AA Sequence

MSDEEVEQVEEQYEEEEEAQEEAAEVHEEVHEPEEVQEDTAEEDAEEEKPRPKLTAPKIPEGEKVDFDDI      1 - 70
QKKRQNKDLMELQALIDSHFEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARRE     71 - 140
EEDAKRRAEDDLKKKKALSSMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDK    141 - 210
AKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK               211 - 269
//

Text Mined References (35)

PMID Year Title