Property Summary

NCBI Gene PubMed Count 17
PubMed Score 199.40
PubTator Score 40.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Combined Oxidative Phosphorylation Deficiency 3 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.0e-03
group 4 medulloblastoma 1855 3.5e-03
psoriasis 6694 4.0e-03
adult high grade glioma 3801 5.2e-03
ependymoma 4679 7.2e-03
aldosterone-producing adenoma 665 1.2e-02
lung cancer 4740 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 5.2e-03
aldosterone-producing adenoma -1.393 1.2e-02
ependymoma -1.200 7.2e-03
group 4 medulloblastoma -1.100 3.5e-03
lung cancer 1.200 1.5e-02
osteosarcoma -1.955 3.0e-03
psoriasis -1.100 4.0e-03

Protein-protein Interaction (9)

Gene RIF (5)

AA Sequence

MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALET      1 - 70
CGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQ     71 - 140
VALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSG    141 - 210
FYVGSYVHGAMQSPSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAE    211 - 280
TKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE                             281 - 325
//

Text Mined References (24)

PMID Year Title