Property Summary

NCBI Gene PubMed Count 193
Grant Count 401
R01 Count 229
Funding $48,522,813.2
PubMed Score 736.76
PubTator Score 438.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 3.600 0.000
primary pancreatic ductal adenocarcinoma -1.268 0.013
gastric carcinoma -1.800 0.041
ovarian cancer -3.300 0.000
pancreatic cancer -1.400 0.003
psoriasis 1.300 0.010

Synonym

Accession P43694 B7ZKX0 B7ZKZ4 Q3MJ45 Q5IFM8
Symbols TOF
ASD2
VSD1
TACHD

Gene

PANTHER Protein Class (2)

PDB

2M9W  

 GWAS Trait (1)

Gene RIF (168)

PMID Text
26946174 results demonstrate that cGMP-PKG signaling mediates transcriptional activity of GATA4 and links defective GATA4 and PKG-1alpha mutations to the development of human heart disease.
26490736 Kaplan-Meier survival analysis revealed significantly shorter overall survival in pediatric Acute myeloid leukemia with GATA4 promoter methylation but multivariate analysis shows that it is not an independent factor.
26404840 GATA4 accumulates in multiple tissues, including the aging brain, and could contribute to aging and its associated inflammation.
26381449 This study showed that GATA4 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders.
26376067 Whole exome sequencing results on four-generation Chinese family with atrial septal defect (ASD) identified a novel mutation in GATA4 gene at the methylation position associated with ASD.
26071180 Data show that the combination of GATA binding protein 4 (Gata4), T-box transcription factor 5 (Tbx5) and BRG1-associated factor 60C protein (Baf60c) is sufficient for inducing adipose tissue-derived mesenchymal stem cells (ADMSCs) to form cardiomyocytes.
25928801 GATA4 genetic variations are associated with congenital heart disease
25873328 this study confirms that GATA4 M310V mutation may lead to the development of the congenital heart defect, ASD.
25524324 Germline mutations in the NKX2-5, GATA4, and CRELD1 genes do not appear to be associated with CHD in Mexican DS patients.
25416133 Lower levels of Gata4 expression enhanced cardiac myocyte reprogramming efficiency.
More...

AA Sequence

MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGS      1 - 70
SGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAG     71 - 140
AGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDD    141 - 210
FSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTT    211 - 280
LWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNS    281 - 350
SNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQT    351 - 420
SSKQDSWNSLVLADSHGDIITA                                                    421 - 442
//

Text Mined References (197)

PMID Year Title
26946174 2016 PKG-1? mediates GATA4 transcriptional activity.
26490736 2015 Hypermethylation of the GATA binding protein 4 (GATA4) promoter in Chinese pediatric acute myeloid leukemia.
26404840 2015 The DNA damage response induces inflammation and senescence by inhibiting autophagy of GATA4.
26381449 2015 The association of DNA methylation and brain volume in healthy individuals and schizophrenia patients.
26376067 2016 A novel mutation of GATA4 (K300T) associated with familial atrial septal defect.
26071180 2015 Gata4, Tbx5 and Baf60c induce differentiation of adipose tissue-derived mesenchymal stem cells into beating cardiomyocytes.
25928801 2015 c.620C>T mutation in GATA4 is associated with congenital heart disease in South India.
25873328 2015 GATA4 transgenic mice as an in vivo model of congenital heart disease.
25524324 2015 Germline mutations in NKX2-5, GATA4, and CRELD1 are rare in a Mexican sample of Down syndrome patients with endocardial cushion and septal heart defects.
25416133 2015 Stoichiometry of Gata4, Mef2c, and Tbx5 influences the efficiency and quality of induced cardiac myocyte reprogramming.
More...