Property Summary

NCBI Gene PubMed Count 64
Grant Count 14
R01 Count 10
Funding $1,008,343.9
PubMed Score 31.80
PubTator Score 24.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.156 0.001
astrocytoma 1.200 0.002
glioblastoma 1.300 0.001
diabetes mellitus -1.200 0.002
ovarian cancer 1.300 0.000

Gene RIF (42)

PMID Text
26655835 Site-specific Rpt3 phosphorylation by DYRK2 controls cell proliferation and tumorigenesis in breast neoplasms.
22944692 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
22370480 Saquinavir-NO inhibits activation of S6 protein in androgen-dependent prostate cancer cells.
21979464 The proposed TRAP1 network has an impact in vivo, as it is conserved in human colorectal cancers, is controlled by ER-localized TRAP1 interacting with TBP7 and provides a novel model of the ER-mitochondria crosstalk.
20937828 C terminus of Rpt3, an ATPase subunit of PA700 (19 S) regulatory complex, is essential for 26 S proteasome assembly but not for activation
18854154 Knockdown of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18446261 An insertion/deletion variant in intron 5 of the S6 ATPase gene was more frequent in German Parkinson's disease patients compared to controls
17327361 a novel specific interaction of synphilin-1 with the regulatory proteasomal protein S6 ATPase (tbp7) in aggresome-like intracytoplasmic inclusions
14614829 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
14564014 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
More...

AA Sequence

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKK      1 - 70
EFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALV     71 - 140
DVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGC    141 - 210
GKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG    211 - 280
ADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITS    281 - 350
KMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK      351 - 418
//

Text Mined References (77)

PMID Year Title
26655835 2016 Site-specific proteasome phosphorylation controls cell proliferation and tumorigenesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22901813 2012 Cancer vulnerabilities unveiled by genomic loss.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22651796 2012 A molecular signature in blood identifies early Parkinson's disease.
22370480 2012 Saquinavir-NO-targeted S6 protein mediates sensitivity of androgen-dependent prostate cancer cells to TRAIL.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...