Property Summary

NCBI Gene PubMed Count 171
Grant Count 1,444
R01 Count 824
Funding $331,913,206.16
PubMed Score 4034.10
PubTator Score 1723.69

Knowledge Summary

Patent (65,374)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.000 0.000

Synonym

Accession P43681 Q4JGR7 Q4VAQ5 Q4VAQ6
Symbols EBN
BFNC
EBN1
NACHR
NACRA4
NACHRA4

Gene

PDB

2GVT   2LLY  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (168)

PMID Text
27054571 Results provide further evidence that common synonymous CHRNA4 exon 5 SNPs affect cognitive processes and suggest that they also play a role in the auditory system.
26684647 Data show alpha4 subunit role in conferring potentiation by 17beta-estradiol (BEST) and indicate that the C-terminal region is involved in both binding of betaEST and potentiation, while the N-terminal domain seems involved in enhancing its efficacy.
26644472 the identity of subunits neighboring the otherwise equivalent alpha4(+)/(-)beta2 agonist sites modifies their contributions to nAChR activation and E-loop residues are an important contributor to this neighbor effect
26612384 Study observed a significant association between the rs1044396 SNP in the CHRNA4 gene and the personality trait harm avoidance
26440539 Common CHRNA4 variant with important regulatory properties that contributes to nicotine dependence and smoking-related consequences was identified.
26125703 CHRNA4 rs1044396 CT/TT genotype is related to cigarette smoking in Parkinson's disease patients.
25934188 findings demonstrate that the complementary alleles of the CHRNA4 exon 5 haplotype differ with respect to mRNA stability, codon usage and agonist sensitivity
25869137 analysis of how an agonist to the binding site promotes activation of alpha4beta2* nicotinic acetylcholine receptors
25729002 study demonstrated that genetic variation of CHRNA4 (rs1044396) increased blink rate while watching a video; suggests that differences in sensitivity to acetylcholine because of the genetic variation are associated with individual differences in spontaneous eye blink rate
25639542 Study investigated whether the rs1044396 polymorphism of the CHRNA4 gene modulates response speed and selective visual attention in the Stroop task, Negative priming task, and Posner-Cuing task in n = 157 healthy participants
More...

AA Sequence

MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSI      1 - 70
AQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTK     71 - 140
AHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWV    141 - 210
IVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCIS    211 - 280
VLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLD    281 - 350
IVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP    351 - 420
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQ    421 - 490
YCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPL    491 - 560
SPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI       561 - 627
//

Text Mined References (173)

PMID Year Title
27054571 2016 Association of Common Polymorphisms in the Nicotinic Acetylcholine Receptor Alpha4 Subunit Gene with an Electrophysiological Endophenotype in a Large Population-Based Sample.
26684647 2015 Potentiation of Neuronal Nicotinic Receptors by 17?-Estradiol: Roles of the Carboxy-Terminal and the Amino-Terminal Extracellular Domains.
26644472 2016 Differential ?4(+)/(-)?2 Agonist-binding Site Contributions to ?4?2 Nicotinic Acetylcholine Receptor Function within and between Isoforms.
26612384 2016 Replication of the association between CHRNA4 rs1044396 and harm avoidance in a large population-based sample.
26440539 2015 Genome-wide meta-analysis reveals common splice site acceptor variant in CHRNA4 associated with nicotine dependence.
26125703 2015 Association of CHRNA4 gene rs1044396 and rs1044397 polymorphisms with Parkinson's disease symptoms and smoking.
25934188 2015 The nicotinic acetylcholine receptor alpha 4 subunit contains a functionally relevant SNP Haplotype.
25869137 2015 An Accessory Agonist Binding Site Promotes Activation of ?4?2* Nicotinic Acetylcholine Receptors.
25729002 2015 Association of a nicotinic receptor gene polymorphism with spontaneous eyeblink rates.
25639542 2015 Individual response speed is modulated by variants of the gene encoding the alpha 4 sub-unit of the nicotinic acetylcholine receptor (CHRNA4).
More...