Property Summary

NCBI Gene PubMed Count 28
PubMed Score 175.20
PubTator Score 424.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 5.1e-07
nephrosclerosis 333 5.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0
Disease Target Count Z-score Confidence
Trigonitis 1 4.672 2.3
Squamous papillomatosis 1 4.362 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.888 5.6e-03
pancreatic ductal adenocarcinoma liver m... -2.518 1.5e-02
psoriasis -1.700 5.1e-07

Gene RIF (10)

AA Sequence

MKLLKLTGFIFFLFFLTESLTLPTQPRDIENFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDM      1 - 70
VEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFP     71 - 140
TLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPVT    141 - 210
QYLKAFSSYQKHVCGALLKFGTKVVHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEGDVVQCIRD    211 - 280
TSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTF    281 - 350
FAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQ    351 - 420
NLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRT    421 - 490
INPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHE    491 - 560
LTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN                                   561 - 599
//

Text Mined References (34)

PMID Year Title