Property Summary

NCBI Gene PubMed Count 27
Grant Count 32
R01 Count 22
Funding $3,503,071.68
PubMed Score 159.73
PubTator Score 424.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.888 0.006
pancreatic ductal adenocarcinoma liver m... -2.518 0.015
psoriasis -1.700 0.000

Gene RIF (9)

PMID Text
25208973 Data suggest that up-regulation of AFM levels in serum in women with polycystic ovary syndrome can be used as a biological markers of those women with increased risk of developing metabolic syndrome, especially those with insulin resistance.
24768783 A linear increase in afamin during pregnancy may serve as basic reference for subsequent investigations of afamin in pregnancy-related disorders.
20858448 Afamin levels were altered significantly in the peritoneal fluid of women with endometriosis compared with disease-free controls.
19336561 Reduced Afamin expression is associated with ovarian cancer.
19046407 afamin might be a new family member of binding/transport proteins contributing to alpha-tocopherol homeostasis at the blood-brain barrier
18976975 Knockdown of afamin (AFM) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15952736 vitamin E-binding properties were confirmed; found abundant presence of this protein in plasma, extravascular fluids such as follicular, and cerebrospinal fluids
12463752 The protein structure of afamin has been determined by homology modeling and its in vitro binding properties confirmed by docking calculations on the proposed structure.
12063119 Binding of bilirubin with human serum albumin was studied by absorption, fluorescence and CD spectroscopy

AA Sequence

MKLLKLTGFIFFLFFLTESLTLPTQPRDIENFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDM      1 - 70
VEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFP     71 - 140
TLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPVT    141 - 210
QYLKAFSSYQKHVCGALLKFGTKVVHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEGDVVQCIRD    211 - 280
TSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTF    281 - 350
FAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQ    351 - 420
NLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRT    421 - 490
INPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHE    491 - 560
LTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN                                   561 - 599
//

Text Mined References (33)

PMID Year Title
25208973 2014 Afamin serum concentrations are associated with insulin resistance and metabolic syndrome in polycystic ovary syndrome.
24768783 2014 The vitamin E-binding protein afamin increases in maternal serum during pregnancy.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21269460 2011 Initial characterization of the human central proteome.
20858448 2010 The vitamin E-binding protein afamin is altered significantly in the peritoneal fluid of women with endometriosis.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19336561 2009 Afamin and apolipoprotein A-IV: novel protein markers for ovarian cancer.
More...