Property Summary

NCBI Gene PubMed Count 126
PubMed Score 0.00
PubTator Score 57.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.5e-10
osteosarcoma 7950 1.0e-04
medulloblastoma, large-cell 6241 4.7e-04

Expression

Gene RIF (110)

AA Sequence

MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTL      1 - 70
HLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQ     71 - 140
AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWS    141 - 210
NSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQ    211 - 280
EPAGNRTVNSEDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (127)

PMID Year Title