Property Summary

NCBI Gene PubMed Count 119
PubMed Score 0.00
PubTator Score 57.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (105)

PMID Text
26476204 Collectively, our data suggest that the KIR 2DS4/1D allelic variance is associated with the outcome of sibling-related HLA-matched HSCT, and that donor subclassification of KIR 2DS4/1D alleles should be considered in this setting.
26206121 genetic polymorphism is associated with the course of Hepatitis C virus infection and the response to therapy
26031759 genetic association study in population in Eastern India: Data suggest that interactions between KIRs (KIR2DL2, KIR2DS4, KIR2DL3) and HLA ligands (HLAC1, HLAC2) contribute significantly toward susceptibility and protection toward type 1 diabetes.
25961063 KIR2DS4 can induce the uptake of CCR7 by KIR2DS4(+) NKG2A(+) natural killer cell clones after interacting with CCR7(+) target cells expressing HLA-Cw4 and HLA-Cw6 alleles.
25724317 KIR2DS4del presence in patients was associated with severity of endometriosis, which, due to strong negative linkage disequilibrium, may suggest an indirect effect of KIR2DS5 absence
25715101 These results highlight the impact of population allele frequency on viral control and identify a novel association between HLA-C04 : 01 in combination with KIR2DS4f and uncontrolled HIV infection.
25503311 Study shows KIR3DL1 and KIR2DS4 gene variants are linked and that the gene KIR2DS5 is only present in the telomeric half of the KIR locus. Study revealed novel insights in the highly organized distribution of KIR genes.
25069714 Response of rheumatoid arthritis patients with medium ESR values to methotrexate treatment may be dependent on the full-length KIR2DS4 gene.
24239756 Possession of the functional and non-functional KIR2DS4 isoforms in the mother and the fetus determines the risk of the vertical HIV-1 transmission.
24112428 lower genotype frequency in children with systemic juvenile idiopathic arthritis
More...

AA Sequence

MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTL      1 - 70
HLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQ     71 - 140
AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWS    141 - 210
NSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQ    211 - 280
EPAGNRTVNSEDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (120)

PMID Year Title
26476204 2016 KIR2DS4 and Its Variant KIR1D Are Associated with Acute Graft-versus-Host Disease, Cytomegalovirus, and Overall Survival after Sibling-Related HLA-Matched Transplantation in Patients with Donors with KIR Gene Haplotype A.
26206121 2016 Genetic (KIR, HLA-C) and Some Clinical Parameters Influencing the Level of Liver Enzymes and Early Virologic Response in Patients with Chronic Hepatitis C.
26031759 2016 Killer immunoglobulin receptor genes and their HLA-C ligand are associated with Type 1 diabetes in an Eastern Indian population.
25961063 2015 Uptake of CCR7 by KIR2DS4? NK cells is induced upon recognition of certain HLA-C alleles.
25724317 2015 KIR2DS5 in the presence of HLA-C C2 protects against endometriosis.
25715101 2015 The HLA-C*04: 01/KIR2DS4 gene combination and human leukocyte antigen alleles with high population frequency drive rate of HIV disease progression.
25503311 2015 Novel insights in the genomic organization and hotspots of recombination in the human KIR locus through analysis of intergenic regions.
25069714 2014 Presence of the full-length KIR2DS4 gene reduces the chance of rheumatoid arthritis patients to respond to methotrexate treatment.
24239756 2013 KIR2DS4 allelic variants: Differential effects on in utero and intrapartum HIV-1 mother-to-child transmission.
24112428 2013 Natural killer cell activity and frequency of killer cell immunoglobulin-like receptors in children with different forms of juvenile idiopathic arthritis.
More...