Property Summary

NCBI Gene PubMed Count 146
PubMed Score 0.00
PubTator Score 78.69

Knowledge Summary

Patent

No data available

Gene RIF (127)

PMID Text
26574972 this study was to look for immunogenetic determinants in the pathogenesis of FMF and find out if KIR are related to susceptibility. An activator KIR gene, KIR2DS2, was significantly more frequent in FMF patients (p=0.036).
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26430804 Single Nucleotide Polymorphism in KIR2DS2 gene is associated with Asthma and Atopic Dermatitis.
26202659 a significant increase in the frequency of KIR2DL2 (P = 0.019) as well as KIR2DS2 (P = 0.008) in patients with neuroblastoma compared with the healthy control group, was found.
25636579 genetic polymorphism is associated with chronic hepatitis C and levels of viremia in Poland
25575065 KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in Han population.
25484131 CD4(+) CD28(-) cells exhibited increased KIR2DS2, reduced KIR2DL3 and increased DAP12 expression in HD-ESRD compared with NDD-CKD patients.
25381437 NK cells with KIR2DS2 immunogenotype have a functional activation advantage to efficiently kill glioblastoma and prolong animal survival.
24550293 Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11.
24185760 There is an association of the KIR2DS gene, especially KIR2DS2, with psoriatic arthritis.
More...

AA Sequence

MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTL      1 - 70
HLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
NSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQ    211 - 280
EPAGNRTVNSEDSDEQDHQEVSYA                                                  281 - 304
//

Text Mined References (146)

PMID Year Title
26574972 2015 Killer Cell Immunoglobulin-Like Receptor (KIR) Genotype Distribution in Familial Mediterranean Fever (FMF) Patients.
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26430804 2015 Imputation of KIR Types from SNP Variation Data.
26202659 2015 Increased frequencies of the killer immunoglobulin-like receptor genes KIR2DL2 and KIR2DS2 are associated with neuroblastoma.
25636579 2015 Contribution of genes for killer cell immunoglobulin-like receptors (KIR) to the susceptibility to chronic hepatitis C virus infection and to viremia.
25575065 2015 [Correlation analysis between killer cell immunoglobulin-like receptor gene polymorphism and primary biliary cirrhosis].
25484131 2015 Killer cell immunoglobulin receptor profile on CD4(+)  CD28(-) T cells and their pathogenic role in non-dialysis-dependent and dialysis-dependent chronic kidney disease patients.
25381437 2014 NK cells with KIR2DS2 immunogenotype have a functional activation advantage to efficiently kill glioblastoma and prolong animal survival.
24571473 2014 The presence of KIR2DS5 confers protection against adult immune thrombocytopenia.
24550293 2014 Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11.
More...