Property Summary

NCBI Gene PubMed Count 104
Grant Count 20
R01 Count 11
Funding $1,447,638.45
PubMed Score 32.00
PubTator Score 59.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.600 0.001

Gene RIF (93)

PMID Text
26928464 Overexpression of a single MHCI molecule, HLA-F, protects human MNs from ALS astrocyte-mediated toxicity, whereas knockdown of its receptor, the killer cell immunoglobulin-like receptor KIR3DL2, on human astrocytes results in enhanced motor neurons death
26841353 KIR-3DL2 binding to HLA-B27 licenses Th17 cell differentiation in spondyloarthritis.
25940819 In early axial spondyloarthritis and ankylosing spondylitis Dutch patients, no copy number changes were found for KIR3DL2.
25867094 we show that the allele KIR3DL2*001 and the single nucleotide polymorphism 1190T (rs3745902) are associated with differential susceptibility to pemphigus
25582852 These findings provide novel insights about the molecular basis of KIR3DL2 binding to B27
25414436 these data provide evidence for a possible role of KIR3DL2 in the maintenance of a high circulating malignant-cell burden by preventing activation-induced cell death.
25361998 our results offer preclinical proof of concept for the clinical development of IPH4102, a humanized monoclonal antibody that targets the immune receptor KIR3DL2,to treat patients with nced cutaneous T-cell lymphoma
25158034 our results show that a multistep gating of CD158k+ cells is reliable to assess tumor burden in case of Sezary syndrome.
25044837 CD158k expression was identified on cutaneous CD4+ T cells in healthy individuals and also mycosis fungoides patients.
25007046 Our results indicate that KIR3DL2 can directly promote Sezary syndrome malignant cell death through the use of CpG ODN.
More...

AA Sequence

MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPI      1 - 70
FHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETV     71 - 140
ILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPS    141 - 210
DPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADF    211 - 280
PLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIF    281 - 350
LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKT    351 - 420
PLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF                                       421 - 455
//

Text Mined References (104)

PMID Year Title
26928464 2016 Major histocompatibility complex class I molecules protect motor neurons from astrocyte-induced toxicity in amyotrophic lateral sclerosis.
26841353 2016 Activation-Induced Killer Cell Immunoglobulin-like Receptor 3DL2 Binding to HLA-B27 Licenses Pathogenic T Cell Differentiation in Spondyloarthritis.
25940819 2015 KIR3DL1 and KIR3DL2 gene copy number variation in axial spondyloarthritis.
25867094 2015 Pemphigus is associated with KIR3DL2 expression levels and provides evidence that KIR3DL2 may bind HLA-A3 and A11 in vivo.
25582852 2015 The D0 Ig-like domain plays a central role in the stronger binding of KIR3DL2 to B27 free H chain dimers.
25414436 2014 KIR3DL2 is a coinhibitory receptor on Sézary syndrome malignant T cells that promotes resistance to activation-induced cell death.
25361998 2014 IPH4102, a humanized KIR3DL2 antibody with potent activity against cutaneous T-cell lymphoma.
25158034 2015 CD158k is a reliable marker for diagnosis of Sézary syndrome and reveals an unprecedented heterogeneity of circulating malignant cells.
25044837 2014 Membrane expression of NK receptors CD160 and CD158k contributes to delineate a unique CD4+ T-lymphocyte subset in normal and mycosis fungoides skin.
25007046 2015 KIR3DL2/CpG ODN interaction mediates Sézary syndrome malignant T cell apoptosis.
More...