Property Summary

NCBI Gene PubMed Count 190
Grant Count 589
R01 Count 259
Funding $118,604,943.9
PubMed Score 198.84
PubTator Score 216.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer -1.200 0.015
diabetes mellitus 1.400 0.001
pancreatic carcinoma -1.200 0.015

Synonym

Accession P43629 O43473 Q14946 Q16541
Symbols KIR
NKB1
NKAT3
NKB1B
NKAT-3
CD158E1
KIR3DL1/S1

Gene

PDB

3VH8   3WUW   5B38   5B39  

Gene RIF (188)

PMID Text
26439909 Using depletion studies and Killer immunoglobulin-like receptors-transfected cell lines, demonstrated that the dengue virus NS1 tetramer bound the inhibitory receptor KIR3DL1.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking
26238044 KIR3DL1 has a protective effect against the more severe manifestations of ankylosing spondylitis.
25940819 In early axial spondyloarthritis and ankylosing spondylitis Dutch patients, no copy number changes were found for KIR3DL1.
25503311 Study shows KIR3DL1 and KIR2DS4 gene variants are linked and that the gene KIR2DS5 is only present in the telomeric half of the KIR locus. Study revealed novel insights in the highly organized distribution of KIR genes.
25480565 the strict conformation of HLA-Bw4 allotypes, held in place by the Glu(76)-Arg(83) interaction, facilitates KIR3DL1 binding, whereas Bw6 allotypes present a platform on the alpha1 helix that is less permissive for KIR3DL1 binding.
25330014 Individuals who carried both KIR3DS1 and Bw4*80I did not remain HIV seronegative longer than those from a control group who were homozygous for HLA-Bw6 and carried no HLA-A locus Bw4 alleles
25320293 KIR3DL1+ NK cells can partially overcome inhibition to exhibit anti-HIV-1 Ab-dependent activation of NK cells, leading to suppress target cells presenting to HIV-1 gp120
25139336 Characterizing Maori and Polynesians is a paucity of HLA-B allotypes recognized by KIR.
25112829 Protective genotypes in HIV infection reflect superior function of KIR3DS1 over KIR3DL1-expressing CD8+ T cells.
More...

AA Sequence

MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPI      1 - 70
FHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERV     71 - 140
ILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPS    141 - 210
DPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF    211 - 280
PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVII    281 - 350
LFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT    351 - 420
PPTDTILYTELPNAKPRSKVVSCP                                                  421 - 444
//

Text Mined References (191)

PMID Year Title
26439909 2016 Interaction of a dengue virus NS1-derived peptide with the inhibitory receptor KIR3DL1 on natural killer cells.
26321090 KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking.
26238044 2015 Study on the protective effect of the KIR3DL1 gene in ankylosing spondylitis.
25940819 2015 KIR3DL1 and KIR3DL2 gene copy number variation in axial spondyloarthritis.
25503311 2015 Novel insights in the genomic organization and hotspots of recombination in the human KIR locus through analysis of intergenic regions.
25480565 2015 The interaction of KIR3DL1*001 with HLA class I molecules is dependent upon molecular microarchitecture within the Bw4 epitope.
25330014 2014 Time to seroconversion in HIV-exposed subjects carrying protective versus non protective KIR3DS1/L1 and HLA-B genotypes.
25139336 2014 KIR diversity in M?ori and Polynesians: populations in which HLA-B is not a significant KIR ligand.
25112829 2015 Protective genotypes in HIV infection reflect superior function of KIR3DS1+ over KIR3DL1+ CD8+ T cells.
24929144 2014 KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C.
More...