Property Summary

NCBI Gene PubMed Count 204
PubMed Score 209.61
PubTator Score 216.27

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.400 1.1e-03
pancreatic cancer -1.200 1.5e-02
pancreatic carcinoma -1.200 1.5e-02

Gene RIF (199)

AA Sequence

MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPI      1 - 70
FHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERV     71 - 140
ILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPS    141 - 210
DPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF    211 - 280
PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVII    281 - 350
LFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT    351 - 420
PPTDTILYTELPNAKPRSKVVSCP                                                  421 - 444
//

Text Mined References (205)

PMID Year Title