Property Summary

NCBI Gene PubMed Count 146
PubMed Score 0.00
PubTator Score 24.78

Knowledge Summary

Patent

No data available

Gene RIF (145)

PMID Text
26542066 KIR2DL2/2DS2-C1C1 genotype is associated with type 1 diabetes in Saudi children
26430804 Single Nucleotide Polymorphism in KIR2DL2 gene is associated with Asthma and Atopic Dermatitis.
26423800 Allelic polymorphism of KIR2DL2/2DL3 in a southern Chinese population.
26202659 a significant increase in the frequency of KIR2DL2 (P = 0.019) as well as KIR2DS2 (P = 0.008) in patients with neuroblastoma compared with the healthy control group, was found.
26031759 genetic association study in population in Eastern India: Data suggest that interactions between KIRs (KIR2DL2, KIR2DS4, KIR2DL3) and HLA ligands (HLAC1, HLAC2) contribute significantly toward susceptibility and protection toward type 1 diabetes.
25636579 genetic polymorphism is associated with chronic hepatitis C and levels of viremia in Poland
25575065 KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in Han population.
25359276 KIR2DL3-positive NK cells were more sensitive to changes in the peptide content of MHC class I than KIR2DL2-positive NK cells.
25329633 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
25188020 Authors showed an increase in HLA-C1/KIR2DL2 and HLA-C1/KIR2DL3 pairs in human papillomavirus high-risk infected patients (OR 3.05, 3.24) with invasive cervical cancer (OR 1.33, 3.68).
More...

AA Sequence

MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTL      1 - 70
HLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
NSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQE    211 - 280
SAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP      281 - 348
//

Text Mined References (146)

PMID Year Title
26542066 2016 Investigation of activating and inhibitory killer cell immunoglobulin-like receptors and their putative ligands in type 1 diabetes (T1D).
26430804 2015 Imputation of KIR Types from SNP Variation Data.
26423800 2015 Allelic polymorphism of KIR2DL2/2DL3 in a southern Chinese population.
26202659 2015 Increased frequencies of the killer immunoglobulin-like receptor genes KIR2DL2 and KIR2DS2 are associated with neuroblastoma.
26031759 2016 Killer immunoglobulin receptor genes and their HLA-C ligand are associated with Type 1 diabetes in an Eastern Indian population.
25636579 2015 Contribution of genes for killer cell immunoglobulin-like receptors (KIR) to the susceptibility to chronic hepatitis C virus infection and to viremia.
25575065 2015 [Correlation analysis between killer cell immunoglobulin-like receptor gene polymorphism and primary biliary cirrhosis].
25359276 2015 Peptide selectivity discriminates NK cells from KIR2DL2- and KIR2DL3-positive individuals.
25329633 2014 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
25188020 2014 Implication of HLA-C and KIR alleles in human papillomavirus infection and associated cervical lesions.
More...