Property Summary

NCBI Gene PubMed Count 150
PubMed Score 0.00
PubTator Score 24.78

Knowledge Summary

Patent

No data available

Gene RIF (146)

AA Sequence

MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTL      1 - 70
HLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVL     71 - 140
AGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWS    141 - 210
NSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQE    211 - 280
SAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP      281 - 348
//

Text Mined References (150)

PMID Year Title