Property Summary

NCBI Gene PubMed Count 145
Grant Count 19
R01 Count 12
Funding $2,690,781.87
PubMed Score 113.87
PubTator Score 116.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (126)

PMID Text
26647083 Educated natural killer cells expressing KIR2DL1 display functional advantage for anti-HIV-1 antibody-dependent activation.
26542066 KIR2DL1-C2C2 is less frequent in type 1 diabetes in Saudi children
26456260 Influence of Differently Licensed KIR2DL1-Positive Natural Killer Cells in Transplant Recipients with Acute Leukemia
26453750 Coengagement of inhibitory receptors, either KIR2DL1 or CD94-NKG2A, did not inhibit phosphorylation of Stat5 but inhibited selectively phosphorylation of Akt and S6 ribosomal protein.
26416275 Data suggest regulatory interactions between major histocompatibility antigen HLA-C and killer cell Ig-like receptor (KIR) might promote Graft-versus-Leukemia effects following transplantation.
26292085 KIR2DL1*022 and 2DL1*026 evolved in the KhoeSan after their divergence from other modern human populations.
25505289 These results revealed that ITIM phosphorylation is controlled by self-association of KIR and that His-36 serves as a gatekeeper to prevent unregulated signaling through KIR2DL1.
25163702 C2 of KIR2DL1 is a novel risk factor, and homozygosity for C1 is a protective factor for childhood B-ALL
25037176 We investigated the association of HLA alleles and KIR ligands according to oligoclonal band status in multiple sclerosis patients.
24951171 genetic association studies in Chinese Han population: Data suggest that the frequency of KIR2DL1 gene is increased in women with pre-eclampsia when homozygous HLA-C2 allele appears in the fetus.
More...

AA Sequence

MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTL      1 - 70
RLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVL     71 - 140
AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWS    141 - 210
KSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQE    211 - 280
SAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP      281 - 348
//

Text Mined References (147)

PMID Year Title
26647083 2016 Functional advantage of educated KIR2DL1(+) natural killer cells for anti-HIV-1 antibody-dependent activation.
26542066 2016 Investigation of activating and inhibitory killer cell immunoglobulin-like receptors and their putative ligands in type 1 diabetes (T1D).
26456260 2016 Influence of Differently Licensed KIR2DL1-Positive Natural Killer Cells in Transplant Recipients with Acute Leukemia: A Japanese National Registry Study.
26453750 2015 NK Cell Proliferation Induced by IL-15 Transpresentation Is Negatively Regulated by Inhibitory Receptors.
26416275 2015 Regulation of Adaptive NK Cells and CD8 T Cells by HLA-C Correlates with Allogeneic Hematopoietic Cell Transplantation and with Cytomegalovirus Reactivation.
26292085 2015 Loss and Gain of Natural Killer Cell Receptor Function in an African Hunter-Gatherer Population.
25505289 2015 A single amino acid change in inhibitory killer cell Ig-like receptor results in constitutive receptor self-association and phosphorylation.
25163702 2014 KIR ligand C2 is associated with increased susceptibility to childhood ALL and confers an elevated risk for late relapse.
25037176 2014 Oligoclonal band phenotypes in MS differ in their HLA class II association, while specific KIR ligands at HLA class I show association to MS in general.
24989671 2014 Characterization of a weakly expressed KIR2DL1 variant reveals a novel upstream promoter that controls KIR expression.
More...