Property Summary

NCBI Gene PubMed Count 371
Grant Count 92
R01 Count 59
Funding $9,073,099.12
PubMed Score 962.16
PubTator Score 881.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P43490 A4D0Q9 A4D0R0 Q3KQV0 Q8WW95 NAmPRTase
Symbols VF
PBEF
PBEF1
VISFATIN
1110035O14Rik

Gene

PANTHER Protein Class (2)

PDB

2E5B   2E5C   2E5D   2GVG   2GVJ   3DGR   3DHD   3DHF   3DKJ   3DKL   4JNM   4JR5   4KFN   4KFO   4KFP   4L4L   4L4M   4LTS   4LV9   4LVA   4LVB   4LVD   4LVF   4LVG   4LWW   4M6P   4M6Q   4N9B   4N9C   4N9D   4N9E   4O0Z   4O10   4O12   4O13   4O14   4O15   4O16   4O17   4O18   4O19   4O1A   4O1B   4O1C   4O1D   4O28   4WQ6   5KIT  

Gene RIF (360)

PMID Text
27491149 The expression of PFKFB3, PFKFB4, NAMPT, and TSPAN13 is strongly up-regulated in pediatric glioma.
26967765 revealed increased likelihood of metabolic and dyslipidemic manifestations in obese compared to non-obese PCOS patients, while no significant difference was noted in visfatin and resistin levels among PCOS patients in terms of co-morbid obesity and in comparison to controls
26886056 There was a positive correlation between visfatin and BAFF serum levels in myositis patients but a negative correlation was observed in healthy subjects
26851003 Increased Nicotinamide Phosphoribosyltransferase is associated with Rhabdomyosarcomas and Leiomyosarcomas.
26558825 NAMPT gene variants previously found to associate among Indian children did not associate with risk of obesity or obesity-related quantitative measures among Caucasian children and juvenile men from Denmark.
26531769 Study demonstrated that NAMPT, VEGF and HER2 were overexpressed in breast tumors as well as in the serum and their circulating levels declined after tumor removal, suggesting a clinical application of this triplet as biomarker for breast cancer diagnosis.
26451650 The review aims to provide a better understanding of the role of visfatin during pregnancy and the causes of its alteration in maternal plasma
26402139 NAMPT could contribute to systemic and plaque inflammation in atherosclerotic disorders at least partly through effect on macrophages
26389889 Rs9034 T allele and CT genotype were associated with increased dilated cardiomyopathy risk.
26358657 extracellular NAMPT can be actively released by melanoma cells in vitro.
More...

AA Sequence

MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYL      1 - 70
KGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPE     71 - 140
CYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASA    141 - 210
HLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDS    211 - 280
YDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV    281 - 350
IQGDGVDINTLQEIVEGMKQKMWSIENIAFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD    351 - 420
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH    421 - 490
H//

Text Mined References (378)

PMID Year Title
27491149 [EXPRESSION OF PFKFB, HK2, NAMPT, TSPAN13 AND HSPB8 GENES IN PEDIATRIC GLIOMA].
26967765 Evaluation of insulin resistance and plasma levels for visfatin and resistin in obese and non-obese patients with polycystic ovary syndrome.
26886056 Increased visfatin levels are associated with higher disease activity in anti-Jo-1-positive myositis patients.
26851003 2016 Increased Nicotinamide Phosphoribosyltransferase in Rhabdomyosarcomas and Leiomyosarcomas Compared to Skeletal and Smooth Muscle Tissue.
26558825 2015 Common variants in LEPR, IL6, AMD1, and NAMPT do not associate with risk of juvenile and childhood obesity in Danes: a case-control study.
26531769 2016 Biomarker triplet NAMPT/VEGF/HER2 as a de novo detection panel for the diagnosis and prognosis of human breast cancer.
26451650 2015 The role of visfatin (PBEF/Nampt) in pregnancy complications.
26402139 2015 Increased expression of NAMPT in PBMC from patients with acute coronary syndrome and in inflammatory M1 macrophages.
26389889 2015 Association of Nicotinamide Phosphoribosyltransferase (NAMPT) Gene Polymorphisms and of Serum NAMPT Levels with Dilated Cardiomyopathy in a Chinese Population.
26358657 2015 Nicotinamide phosphoribosyltransferase (NAMPT/PBEF/visfatin) is a tumoural cytokine released from melanoma.
More...