Property Summary

NCBI Gene PubMed Count 91
Grant Count 238
R01 Count 143
Funding $20,818,397.92
PubMed Score 398.72
PubTator Score 199.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 1.200 0.000
psoriasis 1.400 0.000

Synonym

Accession P43489 Q13663 Q2M312 Q5T7M0
Symbols OX40
ACT35
CD134
IMD16
TXGP1L

Gene

PDB

1D0A   2HEV   2HEY  

Gene RIF (75)

PMID Text
26872462 blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation.
26755473 OX40 and its ligand are co stimulators for T lymphocytes.
26467721 These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication.
26439988 Low OX40 expression is associated with colorectal cancer.
26202244 Identified two key amino acid residues within CD134 that are required for its interaction with herpesvirus 6B (HHV-6B) and for HHV-6B entry into cells. One of the residues (K79) allows access of the HHV-6B ligand to CD134.
26070486 contributes to the aberrant T Follicular Helper response in systemic lupus erythematosus
25891357 Malaria patients and Plasmodium-infected rodents exhibit enhanced expression of the co-stimulatory receptor OX40 on CD4 T cells, which is abrogated following coordinate PD-1 co-inhibitory pathways, which are also upregulated during malaria.
25359291 Data indicate that soluble OX40 and sOX40L plasma levels are increased in early rheumatoid arthritis patients.
25148371 TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells
25008928 A cysteine-rich domain of CD134 that is critical for binding to the HHV-6B glycoprotein gH/gL/gQ1/gQ2 complex and HHV-6B infection.
More...

AA Sequence

MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPG      1 - 70
FYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQA     71 - 140
CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP    141 - 210
GGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI       211 - 277
//

Text Mined References (93)

PMID Year Title
26872462 2016 Effector function of CTLs is increased by irradiated colorectal tumor cells that modulate OX-40L and 4-1BBL and is reversed following dual blockade.
26755473 2015 Lack of Association Between rs17568 Polymorphism in OX40 Gene and Myocardial Infarction, Southern of Iran.
26467721 2015 OX40 and 4-1BB downregulate Kaposi’s sarcoma-associated herpesvirus replication in lymphatic endothelial cells, but 4-1BB and not OX40 inhibits viral replication in B-cells.
26439988 2015 OX40 expression enhances the prognostic significance of CD8 positive lymphocyte infiltration in colorectal cancer.
26202244 2015 Determinants of Human CD134 Essential for Entry of Human Herpesvirus 6B.
26070486 2015 OX40 Ligand Contributes to Human Lupus Pathogenesis by Promoting T Follicular Helper Response.
25891357 2015 PD-1 Co-inhibitory and OX40 Co-stimulatory Crosstalk Regulates Helper T Cell Differentiation and Anti-Plasmodium Humoral Immunity.
25359291 2014 Soluble OX40L is associated with presence of autoantibodies in early rheumatoid arthritis.
25148371 2014 TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells.
25008928 2014 Detailed study of the interaction between human herpesvirus 6B glycoprotein complex and its cellular receptor, human CD134.
More...