Property Summary

NCBI Gene PubMed Count 392
Grant Count 661
R01 Count 442
Funding $73,711,053.74
PubMed Score 1349.29
PubTator Score 863.61

Knowledge Summary

Patent (140,169)

Expression

Synonym

Accession P43405
Symbols p72-Syk

Gene

SYK

PDB

3BUW   1A81   1CSY   1CSZ   1XBA   1XBB   1XBC   3EMG   3FQE   3FQH   3FQS   3SRV   3TUB   3TUC   3TUD   3VF8   3VF9   4DFL   4DFN   4F4P   4FL1   4FL2   4FL3   4FYN   4FYO   4FZ6   4FZ7   4GFG   4I0R   4I0S   4I0T   4PUZ   4PV0   4PX6   4RSS   4RX7   4RX8   4RX9   4WNM   4XG2   4XG3   4XG4   4XG6   4XG7   4XG8   4XG9   4YJO   4YJP   4YJQ   4YJR   4YJS   4YJT   4YJU   4YJV   5C26   5C27   5CXH   5CXZ   5CY3   5GHV   5LMA   5LMB  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (232)

PMID Text
26884848 SYK expression was down-regulated in laryngeal squamous cell carcinoma, which was closely correlated with cancer growth and lymph node metastasis. SYK up-regulation was able to inhibit the invasion and metastasis of LSCC.
26582197 Data suggest that immune complexes (ICs) of FCGR3A-SYK play critical role in activation of CD4+ T-cells and thus in modulation of adaptive immunity; such ICs are present in blood from patients with systemic lupus erythematosus.
26429917 this study shows that the treatment of cells with inducers of stress granule formation leads to the recruitment of Syk to these protein-RNA complexes
26404525 LMPs are important pro-apoptotic regulators for Rb cells through reduction of SYK expression.
26315286 Study establishes P-SYK as a critical biomarker in AML that identifies tumors sensitive to SYK inhibition, identifies an at-risk patient population, and allows for the monitoring of target inhibition during treatment.
26251216 Syk activation is prominent in infiltrating myeloid cells in human rapidly progressive glomerulonephritis
26212014 TNF activates Mule by inducing the dissociation of Mule from its inhibitor ARF. Inhibition of Mule phosphorylation by silencing Syk prevents this, thereby inhibiting Mule E3 ligase activity and TNF-induced JNK activation and cell death.
26202982 Data indicate that MINCLE receptor is able to mediate the response to trehalose-6,6-dimycolate (TDM) dependent on SYK kinase and CARD9 protein.
26187144 The differential requirements of ZAP70 and SYK during thymic development.
26096845 Results show that paclitaxel-resistant cells expressed higher level of phospho-SYK targeting tubulins and microtubule-associated proteins.
More...

AA Sequence

MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIEREL      1 - 70
NGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQG     71 - 140
QALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHE    141 - 210
GKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSH    211 - 280
PATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYES    281 - 350
PYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE    351 - 420
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNF    421 - 490
VHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGV    491 - 560
LMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY    561 - 630
YDVVN                                                                     631 - 635
//

Text Mined References (400)

PMID Year Title
26884848 2015 Full-length spleen tyrosine kinase inhibits the invasion and metastasis of human laryngeal squamous cell carcinoma.
26582197 2016 Fc?RIIIa-Syk Co-signal Modulates CD4+ T-cell Response and Up-regulates Toll-like Receptor (TLR) Expression.
26429917 2015 Syk Is Recruited to Stress Granules and Promotes Their Clearance through Autophagy.
26404525 2015 SYK is a target of lymphocyte-derived microparticles in the induction of apoptosis of human retinoblastoma cells.
26315286 2015 Increased SYK activity is associated with unfavorable outcome among patients with acute myeloid leukemia.
26251216 2016 Myeloid cell-mediated renal injury in rapidly progressive glomerulonephritis depends upon spleen tyrosine kinase.
26212014 2016 Syk-mediated tyrosine phosphorylation of mule promotes TNF-induced JNK activation and cell death.
26202982 2015 Contribution of MINCLE-SYK Signaling to Activation of Primary Human APCs by Mycobacterial Cord Factor and the Novel Adjuvant TDB.
26187144 2015 SYK expression endows human ZAP70-deficient CD8 T cells with residual TCR signaling.
26096845 2015 Inhibition of Spleen Tyrosine Kinase Potentiates Paclitaxel-Induced Cytotoxicity in Ovarian Cancer Cells by Stabilizing Microtubules.
More...