Property Summary

Ligand Count 848
NCBI Gene PubMed Count 418
PubMed Score 1437.44
PubTator Score 863.61

Knowledge Summary

Patent (140,169)

TINX Plot

  Disease (5)

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.400 8.7e-03
Astrocytoma, Pilocytic 1.200 6.6e-06
diabetes mellitus -1.200 1.9e-02
glioblastoma 1.100 6.6e-03
intraductal papillary-mucinous adenoma (... 1.100 1.3e-02
intraductal papillary-mucinous carcinoma... 1.600 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.8e-02
invasive ductal carcinoma 1.060 7.9e-04
lung cancer 1.500 1.3e-02
lung carcinoma -1.900 6.3e-28
medulloblastoma, large-cell 1.400 1.4e-02
Multiple myeloma -1.027 3.3e-02
osteosarcoma -3.212 8.4e-06
ovarian cancer 1.200 2.0e-03
primary Sjogren syndrome 1.500 2.8e-03
psoriasis 1.100 5.4e-08
subependymal giant cell astrocytoma 2.099 1.3e-02
tuberculosis 1.200 1.4e-05
urothelial carcinoma -1.300 7.2e-04
Waldenstrons macroglobulinemia 1.921 1.0e-03

Gene RIF (255)

AA Sequence

MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIEREL      1 - 70
NGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQG     71 - 140
QALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHE    141 - 210
GKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSH    211 - 280
PATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYES    281 - 350
PYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE    351 - 420
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNF    421 - 490
VHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGV    491 - 560
LMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY    561 - 630
YDVVN                                                                     631 - 635
//

Text Mined References (426)

PMID Year Title