Property Summary

NCBI Gene PubMed Count 263
PubMed Score 772.43
PubTator Score 1050.46

Knowledge Summary

Patent (114,997)

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 0.035
osteosarcoma -1.683 0.000
interstitial cystitis 1.700 0.003
ovarian cancer -1.100 0.001

Synonym

Accession P43403 A6NFP4 Q6PIA4 Q8IXD6 Q9UBS6
Symbols SRK
STD
TZK
STCD
IMD48
ADMIO2
ZAP-70

Gene

PDB

3ZNI   4A4B   4A4C   1FBV   2CBL   2Y1N   1M61   1U59   2OQ1   2OZO   4K2R   4XZ0   4XZ1  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (184)

PMID Text
27052731 Cellular studies with ZAP70 showed that multiple lipids bind its C-terminal SH2 domain in a spatiotemporally specific manner and thereby exert exquisite spatiotemporal control over its protein binding and signaling activities in T cells.
26783323 Whole-exome sequencing performed on five family members revealed two affected siblings to be compound heterozygous for two unique missense mutations in the 70-kD T cell receptor zeta-chain associated protein (ZAP-70).
26620225 In all, our study demonstrates that miR-631 decreases PCa cell migration and invasion by dampening ZAP70 expression.
26508782 Activation of innate immune receptors induces an antiapoptotic signal and proliferation in ZAP-70-positive chronic lymphocytic leukemia dependent on Syk activation.
26306999 The data suggest that ZO-1, along with CD38 and Zap-70, plays a role in cell cycle regulation in chronic B cell leukemia, and may be used as a prognostic marker in the disease monitoring.
26246585 A distinct set of proteins interaction partners required for chemokine-directed T cell migration is attracted by phosphotyrosine 571 of ADAP, including ZAP70.
26187144 The differential requirements of ZAP70 and SYK during thymic development.
26139098 Blockade of CXCR7 suppressed MIF-mediated ERK- and zeta-chain-associated protein kinase (ZAP)-70 activation
26002513 results provide the first evidence for differential expression of CD27 among CLL prognostic groups, suggest a role for ZAP-70 dependent signaling in CD27 induction and implicate CD27 in cell-cell interactions with the lymphoid tissue microenvironment
25990959 The kinase activity of ZAP-70 stimulates negative feedback pathways that target Lck and thereby modulate the phosphorylation patterns of the immunoreceptor tyrosine-based activation motifs of t cell receptors.
More...

AA Sequence

MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYA      1 - 70
IAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQ     71 - 140
AIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYH    141 - 210
YLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHP    211 - 280
QRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFG    281 - 350
SVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG    351 - 420
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADD    421 - 490
SYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMEC    491 - 560
PPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACA               561 - 619
//

Text Mined References (279)

PMID Year Title
27052731 2016 SH2 Domains Serve as Lipid-Binding Modules for pTyr-Signaling Proteins.
26783323 2016 A novel human autoimmune syndrome caused by combined hypomorphic and activating mutations in ZAP-70.
26620225 2016 MiR-631/ZAP70: A novel axis in the migration and invasion of prostate cancer cells.
26508782 2016 Integration of innate into adaptive immune responses in ZAP-70-positive chronic lymphocytic leukemia.
26306999 2016 ZO-1 expression shows prognostic value in chronic B cell leukemia.
26246585 2015 Analysis of Phosphorylation-dependent Protein Interactions of Adhesion and Degranulation Promoting Adaptor Protein (ADAP) Reveals Novel Interaction Partners Required for Chemokine-directed T cell Migration.
26187144 2015 SYK expression endows human ZAP70-deficient CD8 T cells with residual TCR signaling.
26139098 2015 MIF interacts with CXCR7 to promote receptor internalization, ERK1/2 and ZAP-70 signaling, and lymphocyte chemotaxis.
26002513 2015 Differential expression and function of CD27 in chronic lymphocytic leukemia cells expressing ZAP-70.
25990959 2015 The catalytic activity of the kinase ZAP-70 mediates basal signaling and negative feedback of the T cell receptor pathway.
More...