Property Summary

NCBI Gene PubMed Count 263
Grant Count 330
R01 Count 173
Funding $29,710,223.72
PubMed Score 772.43
PubTator Score 1050.46

Knowledge Summary

Patent (114,997)

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 0.035
osteosarcoma -1.683 0.000
interstitial cystitis 1.700 0.003
ovarian cancer -1.100 0.001

Synonym

Accession P43403 A6NFP4 Q6PIA4 Q8IXD6 Q9UBS6
Symbols SRK
STD
TZK
STCD
IMD48
ADMIO2
ZAP-70

Gene

PDB

3ZNI   4A4B   4A4C   1FBV   2CBL   2Y1N   1M61   1U59   2OQ1   2OZO   4K2R   4XZ0   4XZ1  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (186)

PMID Text
27052731 Cellular studies with ZAP70 showed that multiple lipids bind its C-terminal SH2 domain in a spatiotemporally specific manner and thereby exert exquisite spatiotemporal control over its protein binding and signaling activities in T cells.
26783323 Whole-exome sequencing performed on five family members revealed two affected siblings to be compound heterozygous for two unique missense mutations in the 70-kD T cell receptor zeta-chain associated protein (ZAP-70).
26620225 In all, our study demonstrates that miR-631 decreases PCa cell migration and invasion by dampening ZAP70 expression.
26508782 Activation of innate immune receptors induces an antiapoptotic signal and proliferation in ZAP-70-positive chronic lymphocytic leukemia dependent on Syk activation.
26306999 The data suggest that ZO-1, along with CD38 and Zap-70, plays a role in cell cycle regulation in chronic B cell leukemia, and may be used as a prognostic marker in the disease monitoring.
26246585 A distinct set of proteins interaction partners required for chemokine-directed T cell migration is attracted by phosphotyrosine 571 of ADAP, including ZAP70.
26187144 The differential requirements of ZAP70 and SYK during thymic development.
26139098 Blockade of CXCR7 suppressed MIF-mediated ERK- and zeta-chain-associated protein kinase (ZAP)-70 activation
26002513 results provide the first evidence for differential expression of CD27 among CLL prognostic groups, suggest a role for ZAP-70 dependent signaling in CD27 induction and implicate CD27 in cell-cell interactions with the lymphoid tissue microenvironment
25990959 The kinase activity of ZAP-70 stimulates negative feedback pathways that target Lck and thereby modulate the phosphorylation patterns of the immunoreceptor tyrosine-based activation motifs of t cell receptors.
More...

AA Sequence

MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYA      1 - 70
IAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQ     71 - 140
AIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYH    141 - 210
YLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHP    211 - 280
QRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFG    281 - 350
SVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG    351 - 420
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADD    421 - 490
SYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMEC    491 - 560
PPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACA               561 - 619
//

Text Mined References (279)

PMID Year Title
27052731 2016 SH2 Domains Serve as Lipid-Binding Modules for pTyr-Signaling Proteins.
26783323 2016 A novel human autoimmune syndrome caused by combined hypomorphic and activating mutations in ZAP-70.
26620225 2016 MiR-631/ZAP70: A novel axis in the migration and invasion of prostate cancer cells.
26508782 2016 Integration of innate into adaptive immune responses in ZAP-70-positive chronic lymphocytic leukemia.
26306999 2016 ZO-1 expression shows prognostic value in chronic B cell leukemia.
26246585 2015 Analysis of Phosphorylation-dependent Protein Interactions of Adhesion and Degranulation Promoting Adaptor Protein (ADAP) Reveals Novel Interaction Partners Required for Chemokine-directed T cell Migration.
26187144 2015 SYK expression endows human ZAP70-deficient CD8 T cells with residual TCR signaling.
26139098 2015 MIF interacts with CXCR7 to promote receptor internalization, ERK1/2 and ZAP-70 signaling, and lymphocyte chemotaxis.
26002513 2015 Differential expression and function of CD27 in chronic lymphocytic leukemia cells expressing ZAP-70.
25990959 2015 The catalytic activity of the kinase ZAP-70 mediates basal signaling and negative feedback of the T cell receptor pathway.
More...