Property Summary

NCBI Gene PubMed Count 22
Grant Count 9
R01 Count 9
Funding $1,189,333.33
PubMed Score 31.38
PubTator Score 24.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.300 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.800 0.000
medulloblastoma, large-cell 1.200 0.000
pediatric high grade glioma 1.200 0.001
Pick disease 1.800 0.000
progressive supranuclear palsy 1.100 0.047

Gene RIF (10)

PMID Text
22763125 This study indentified VEGFR2 as a PTPN9 substrate, and indicated that PTPN9 is a negative regulator of VEGFR2 signaling and function in endothelial cells.
22394684 PTPMeg2 is an important phosphatase for the dephosphorylation of STAT3 and plays a critical role in breast cancer development.
20335174 data suggest PTPN9 as a negative regulator of breast cancer cells by targeting ErbB2 and EGFR and inhibiting STAT activation
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies PTPN9/PTP-MEG2, a member of the protein tyrosine phosphatase family, is important for HIV-1 replication
17387180 the N terminus of PTPMEG2 is necessary for the targeting of this phosphatase to the secretory vesicle compartment by association with other proteins involved in intracellular transport.
16679294 role in the negative regulation of hepatic insulin signaling
15322554 PTP-MEG2 reduced the phosphotyrosine content of NSF and co-localized with NSF and syntaxin 6 in intact cells, the first demonstrated role for a protein tyrosine phosphatase in the regulated secretory pathway
14662869 PTPase-MEG2 through its Sec14p homology domain couples inositide phosphorylation to tyrosine dephosphorylation and the regulation of intracellular traffic of the secretory pathway in T cells.
12920026 PTP-MEG2 has an important role in the development of erythroid cells.
12112018 Purification and characterization of protein tyrosine phosphatase PTP-MEG2

AA Sequence

MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLRAIELFHSYRE      1 - 70
TRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPHKSVQHVVLQALFYLLDRAVD     71 - 140
SFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKV    141 - 210
RERIQILKTSEVTQHLPRECLPENLGGYVKIDLATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHV    211 - 280
PGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRS    281 - 350
GHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK    351 - 420
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQ    421 - 490
QSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQT    491 - 560
PEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ                                         561 - 593
//

Text Mined References (26)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22763125 2012 Tyrosine phosphatase PTP-MEG2 negatively regulates vascular endothelial growth factor receptor signaling and function in endothelial cells.
22394684 2012 Protein tyrosine phosphatase Meg2 dephosphorylates signal transducer and activator of transcription 3 and suppresses tumor growth in breast cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20335174 2010 Protein-tyrosine phosphatase PTPN9 negatively regulates ErbB2 and epidermal growth factor receptor signaling in breast cancer cells.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
More...