Property Summary

Ligand Count 1
NCBI Gene PubMed Count 23
PubMed Score 33.87
PubTator Score 24.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 4.3e-08
glioblastoma 1.800 2.2e-05
medulloblastoma, large-cell 1.200 2.0e-05
pediatric high grade glioma 1.200 8.6e-04
Pick disease 1.800 3.4e-05
progressive supranuclear palsy 1.100 4.7e-02
psoriasis -2.300 1.1e-04

Synonym

Accession P43378 Q53XR9
Symbols MEG2
PTPMEG2

Gene

PDB

2PA5   4GE2   4GE5   4GE6   4ICZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLRAIELFHSYRE      1 - 70
TRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPHKSVQHVVLQALFYLLDRAVD     71 - 140
SFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKV    141 - 210
RERIQILKTSEVTQHLPRECLPENLGGYVKIDLATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHV    211 - 280
PGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRS    281 - 350
GHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK    351 - 420
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQ    421 - 490
QSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQT    491 - 560
PEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ                                         561 - 593
//

Text Mined References (27)

PMID Year Title