Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.39
PubTator Score 7.99

Knowledge Summary

Patent

No data available

Synonym

Accession P43366 B2RC79 O00601 O75862 Q6FHJ0 Q96CW8
Symbols CT3.1
DAM10
MAGEL1
MAGE-Xp

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
12018852 Results show that hypertonic culture medium differentially induces the expression of melanoma antigens B1 and B2 (MAGE-B1, -B2) in different human tumor cell lines.

AA Sequence

MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTA      1 - 70
AAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDE     71 - 140
KYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGVIFL    141 - 210
KGNSATEEEIWKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAET    211 - 280
TKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSHPM       281 - 347
//

Text Mined References (11)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12018852 2002 Hypertonicity induction of melanoma antigen, a tumor-associated antigen.
9441743 1997 Two members of the human MAGEB gene family located in Xp21.3 are expressed in tumors of various histological origins.
8535061 1995 A family of rapidly evolving genes from the sex reversal critical region in Xp21.
More...