Property Summary

NCBI Gene PubMed Count 23
PubMed Score 21.71
PubTator Score 17.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 2.5e-08
non-small cell lung cancer 2890 7.7e-06
malignant mesothelioma 3232 1.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Melanoma 711 3.74 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 6.300 2.5e-08
malignant mesothelioma -2.000 1.7e-05
non-small cell lung cancer 1.691 7.7e-06

Gene RIF (5)

AA Sequence

MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTLREVPAAESPSPPHSPQGAST      1 - 70
LPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVI     71 - 140
RNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTGLLIIVLAIIA    141 - 210
KEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE    211 - 280
TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE                                        281 - 314
//

Text Mined References (27)

PMID Year Title