Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
R01 Count 5
Funding $244,469.67
PubMed Score 20.26
PubTator Score 17.66

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (5)

PMID Text
23950870 Data show the Differences in high resolution melting analysis in promoters of tumor markers neuronal membrane glycoprotein M6-B, melanoma antigen family A12 and immunoglobulin superfamily Fc receptor indicated invasiveness of hepatocellular carcinoma.
22707303 To identify novel CTL epitopes from MAGE-A6 and MAGE-A12 antigens.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
18057533 results of this study may indicate Melanoma associated-A12 antigen(MAGE-A12)as a diagnostic marker for early detection of oral squamous cell carcinoma
17634428 These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes.

AA Sequence

MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTLREVPAAESPSPPHSPQGAST      1 - 70
LPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVI     71 - 140
RNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTGLLIIVLAIIA    141 - 210
KEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE    211 - 280
TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE                                        281 - 314
//

Text Mined References (23)

PMID Year Title
23950870 2013 Discovery and validation of DNA hypomethylation biomarkers for liver cancer using HRM-specific probes.
23574628 2013 Preferential expression of cancer/testis genes in cancer stem-like cells: proposal of a novel sub-category, cancer/testis/stem gene.
23090077 Characterization of T-cell receptors directed against HLA-A*01-restricted and C*07-restricted epitopes of MAGE-A3 and MAGE-A12.
22707303 2012 Identification of novel MAGE-A6- and MAGE-A12-derived HLA-A24-restricted cytotoxic T lymphocyte epitopes using an in silico peptide-docking assay.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
18057533 2008 Expression of MAGE-A12 in oral squamous cell carcinoma.
17942928 2007 MAGE-A, mMage-b, and MAGE-C proteins form complexes with KAP1 and suppress p53-dependent apoptosis in MAGE-positive cell lines.
17634428 2007 Methyl-CpG binding domain proteins and their involvement in the regulation of the MAGE-A1, MAGE-A2, MAGE-A3, and MAGE-A12 gene promoters.
16687489 2006 Promoter demethylation and histone acetylation mediate gene expression of MAGE-A1, -A2, -A3, and -A12 in human cancer cells.
15772651 2005 The DNA sequence of the human X chromosome.
More...