Property Summary

NCBI Gene PubMed Count 20
PubMed Score 20.26
PubTator Score 17.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 2.50022118688847E-8
non-small cell lung cancer 2798 7.65411213030253E-6
malignant mesothelioma 3163 1.67847801818652E-5
Disease Target Count Z-score Confidence
Melanoma 261 3.737 1.9

Gene RIF (5)

PMID Text
23950870 Data show the Differences in high resolution melting analysis in promoters of tumor markers neuronal membrane glycoprotein M6-B, melanoma antigen family A12 and immunoglobulin superfamily Fc receptor indicated invasiveness of hepatocellular carcinoma.
22707303 To identify novel CTL epitopes from MAGE-A6 and MAGE-A12 antigens.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
18057533 results of this study may indicate Melanoma associated-A12 antigen(MAGE-A12)as a diagnostic marker for early detection of oral squamous cell carcinoma
17634428 These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes.

AA Sequence

MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTLREVPAAESPSPPHSPQGAST      1 - 70
LPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVI     71 - 140
RNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTGLLIIVLAIIA    141 - 210
KEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE    211 - 280
TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE                                        281 - 314
//

Text Mined References (23)

PMID Year Title
23950870 2013 Discovery and validation of DNA hypomethylation biomarkers for liver cancer using HRM-specific probes.
23574628 2013 Preferential expression of cancer/testis genes in cancer stem-like cells: proposal of a novel sub-category, cancer/testis/stem gene.
23090077 Characterization of T-cell receptors directed against HLA-A*01-restricted and C*07-restricted epitopes of MAGE-A3 and MAGE-A12.
22707303 2012 Identification of novel MAGE-A6- and MAGE-A12-derived HLA-A24-restricted cytotoxic T lymphocyte epitopes using an in silico peptide-docking assay.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
18057533 2008 Expression of MAGE-A12 in oral squamous cell carcinoma.
17942928 2007 MAGE-A, mMage-b, and MAGE-C proteins form complexes with KAP1 and suppress p53-dependent apoptosis in MAGE-positive cell lines.
17634428 2007 Methyl-CpG binding domain proteins and their involvement in the regulation of the MAGE-A1, MAGE-A2, MAGE-A3, and MAGE-A12 gene promoters.
16687489 2006 Promoter demethylation and histone acetylation mediate gene expression of MAGE-A1, -A2, -A3, and -A12 in human cancer cells.
15772651 2005 The DNA sequence of the human X chromosome.
More...