Property Summary

NCBI Gene PubMed Count 26
Grant Count 25
Funding $3,268,318.37
PubMed Score 18.87
PubTator Score 40.99

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (15)

PMID Text
26330556 degradation of MAGE-A11 promoted by the human p14-ARF tumor suppressor contributes to low levels of MAGE-A11 in nontransformed cells
24316396 MAGE-A9 and MAGE-A11 are tumor-specific antigens and not only DNA hypermethylation but also histone deacetylation is responsible for the mechanism underlying MAGE-A9 and MAGE-A11 gene silencing.
23853093 MAGE-A11 is a proto-oncogene whose increased expression in prostate cancer reverses retinoblastoma-related protein p107 from a transcriptional repressor to a transcriptional activator of the androgen receptor and E2F1.
23839233 MAGEA11 regulation is highly instructive for understanding mechanisms regulating CG antigen genes in human cancer.
23172223 MAGE-A11 increases AR transcriptional activity by linking androgen receptor dimers.
23064813 MAGE-A11, similarly to HER-2 and ER-beta, may be an important diagnostic or prognostic indicator in breast cancer and potentially promotes tumor proliferation.
22334658 the functional defect associated with an AR exon 1 missense mutation.
21730049 Gain in transcriptional activity by primate-specific coevolution of melanoma antigen-A11 and its interaction site in androgen receptor.
20448036 MAGE-11 links NH(2)-terminal domains of AR and p300 to promote transcriptional synergy through a cadre of FXXLF-related interacting motifs
19828458 Results suggest that MAGE-11 functions as a bridging factor to recruit androgen receptor coactivators through a novel FXX(L/I)F motif-F-box interaction paradigm.
More...

AA Sequence

METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDLPRVQVFREQA      1 - 70
NLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHCKPEEGLQAQEEDLGLVGAQA     71 - 140
LQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPD    141 - 210
LIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVK    211 - 280
EVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHF    281 - 350
LFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYED    351 - 420
ALREEGEGV                                                                 421 - 429
//

Text Mined References (26)

PMID Year Title
26330556 2015 Post-translational Down-regulation of Melanoma Antigen-A11 (MAGE-A11) by Human p14-ARF Tumor Suppressor.
25416956 2014 A proteome-scale map of the human interactome network.
24316396 2014 Expressions of MAGE-A9 and MAGE-A11 in breast cancer and their expression mechanism.
23853093 2013 Proto-oncogene activity of melanoma antigen-A11 (MAGE-A11) regulates retinoblastoma-related p107 and E2F1 proteins.
23839233 2013 DNA methylation and nucleosome occupancy regulate the cancer germline antigen gene MAGEA11.
23172223 2013 Melanoma antigen-A11 (MAGE-A11) enhances transcriptional activity by linking androgen receptor dimers.
23064813 2013 Expression of MAGE-A11 in breast cancer tissues and its effects on the proliferation of breast cancer cells.
22334658 2012 Androgen receptor exon 1 mutation causes androgen insensitivity by creating phosphorylation site and inhibiting melanoma antigen-A11 activation of NH2- and carboxyl-terminal interaction-dependent transactivation.
21730049 2011 Gain in transcriptional activity by primate-specific coevolution of melanoma antigen-A11 and its interaction site in androgen receptor.
20448036 2010 Transcriptional synergy between melanoma antigen gene protein-A11 (MAGE-11) and p300 in androgen receptor signaling.
More...