Property Summary

NCBI Gene PubMed Count 34
PubMed Score 22.21
PubTator Score 40.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.3e-17
malignant mesothelioma 3232 4.5e-10
non-small cell lung cancer 2890 2.3e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Melanoma 711 4.126 2.1

Synonym

Accession P43364 Q5ETU4 Q6ZRZ5
Symbols CT1.11
MAGE11
MAGE-11
MAGEA-11

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (21)

AA Sequence

METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDLPRVQVFREQA      1 - 70
NLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHCKPEEGLQAQEEDLGLVGAQA     71 - 140
LQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPD    141 - 210
LIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVK    211 - 280
EVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHF    281 - 350
LFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYED    351 - 420
ALREEGEGV                                                                 421 - 429
//

Text Mined References (34)

PMID Year Title