Property Summary

NCBI Gene PubMed Count 16
PubMed Score 20.88
PubTator Score 28.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.99149900122238E-6
lung cancer 4473 1.87207513722798E-4
ovarian cancer 8492 0.00467320083476128
osteosarcoma 7933 0.0280617203491493
Disease Target Count Z-score Confidence
Cancer 2346 3.154 1.6

Synonym

Accession P43363
Symbols CT1.10
MAGE10

Gene

PANTHER Protein Class (1)

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid

Gene RIF (5)

PMID Text
26191258 CTAs (MAGE-A4, NY-ESO-1, MAGE-A10) were more likely expressed in patients with squamous cell carcinoma of the lung and when CTAs combined with CD133, they can be better prognostic factors.
26058806 By using Molecular-Docking, 3 MAGEA10 peptides were found binding to the groove position of HLA-A( *)0210 same as MAGEA4 peptide co-crystallized with HLA-A( *)0210, which indicates they could be promising for HLA-A( *)0201 presentation in immunotherapy.
22116775 We clearly showed that MAGE-A10 is frequently expressed in the group of triple-negative breast cancer patients
21710496 High MAGE-A10 is associated with lung, skin and urothelial malignancies.
15355897 This is the first report of these MAGE-A10 alternative splice sequences, and characterization of MAGE-A expression

AA Sequence

MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPST      1 - 70
PEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTD     71 - 140
LVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLT    141 - 210
YDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENY    211 - 280
LEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDD    281 - 350
TTAMASASSSATGSFSYPE                                                       351 - 369
//

Text Mined References (17)

PMID Year Title
26191258 2015 Predictive and prognostic effect of CD133 and cancer-testis antigens in stage Ib-IIIA non-small cell lung cancer.
26058806 2015 MAGEA10 gene expression in non-small cell lung cancer and A549 cells, and the affinity of epitopes with the complex of HLA-A(?)0201 alleles.
22116775 2012 High expression of MAGE-A10 cancer-testis antigen in triple-negative breast cancer.
21710496 2011 MAGE-A10 is a nuclear protein frequently expressed in high percentages of tumor cells in lung, skin and urothelial malignancies.
18322177 2008 The use of filamentous bacteriophage fd to deliver MAGE-A10 or MAGE-A3 HLA-A2-restricted peptides and to induce strong antitumor CTL responses.
18237105 2008 Prognostic impact of cancer/testis antigen expression in advanced stage multiple myeloma patients.
17650306 2007 Breast cancer is a promising target for vaccination using cancer-testis antigens known to elicit immune responses.
17039243 2007 Tissue homing and persistence of defined antigen-specific CD8+ tumor-reactive T-cell clones in long-term melanoma survivors.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...