Property Summary

NCBI Gene PubMed Count 16
PubMed Score 20.88
PubTator Score 28.92

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (5)

PMID Text
26191258 CTAs (MAGE-A4, NY-ESO-1, MAGE-A10) were more likely expressed in patients with squamous cell carcinoma of the lung and when CTAs combined with CD133, they can be better prognostic factors.
26058806 By using Molecular-Docking, 3 MAGEA10 peptides were found binding to the groove position of HLA-A( *)0210 same as MAGEA4 peptide co-crystallized with HLA-A( *)0210, which indicates they could be promising for HLA-A( *)0201 presentation in immunotherapy.
22116775 We clearly showed that MAGE-A10 is frequently expressed in the group of triple-negative breast cancer patients
21710496 High MAGE-A10 is associated with lung, skin and urothelial malignancies.
15355897 This is the first report of these MAGE-A10 alternative splice sequences, and characterization of MAGE-A expression

AA Sequence

MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPST      1 - 70
PEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTD     71 - 140
LVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLT    141 - 210
YDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENY    211 - 280
LEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDD    281 - 350
TTAMASASSSATGSFSYPE                                                       351 - 369
//

Text Mined References (17)

PMID Year Title
26191258 2015 Predictive and prognostic effect of CD133 and cancer-testis antigens in stage Ib-IIIA non-small cell lung cancer.
26058806 2015 MAGEA10 gene expression in non-small cell lung cancer and A549 cells, and the affinity of epitopes with the complex of HLA-A(?)0201 alleles.
22116775 2012 High expression of MAGE-A10 cancer-testis antigen in triple-negative breast cancer.
21710496 2011 MAGE-A10 is a nuclear protein frequently expressed in high percentages of tumor cells in lung, skin and urothelial malignancies.
18322177 2008 The use of filamentous bacteriophage fd to deliver MAGE-A10 or MAGE-A3 HLA-A2-restricted peptides and to induce strong antitumor CTL responses.
18237105 2008 Prognostic impact of cancer/testis antigen expression in advanced stage multiple myeloma patients.
17650306 2007 Breast cancer is a promising target for vaccination using cancer-testis antigens known to elicit immune responses.
17039243 2007 Tissue homing and persistence of defined antigen-specific CD8+ tumor-reactive T-cell clones in long-term melanoma survivors.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...