Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.97

Knowledge Summary

Patent

No data available

AA Sequence

MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEEVSAAGSSSPPQSPQGGASSSIS      1 - 70
VYYTLWSQFDEGSSSQEEEEPSSSVDPAQLEFMFQEALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIK     71 - 140
NYKRYFPVIFGKASEFMQVIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKAALLIIVLGVILT    141 - 210
KDNCAPEEVIWEALSVMGVYVGKEHMFYGEPRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHAET    211 - 280
SYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV                                       281 - 315
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20598277 2010 Terminal osseous dysplasia is caused by a single recurrent mutation in the FLNA gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9147653 1997 Molecular and phenotypic variation in patients with severe Hunter syndrome.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.