Property Summary

NCBI Gene PubMed Count 8
PubMed Score 23.28

Knowledge Summary

Patent

No data available

AA Sequence

MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEEVSAAGSSSPPQSPQGGASSSIS      1 - 70
VYYTLWSQFDEGSSSQEEEEPSSSVDPAQLEFMFQEALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIK     71 - 140
NYKRYFPVIFGKASEFMQVIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKAALLIIVLGVILT    141 - 210
KDNCAPEEVIWEALSVMGVYVGKEHMFYGEPRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHAET    211 - 280
SYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV                                       281 - 315
//

Text Mined References (9)

PMID Year Title