Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.22
PubTator Score 7.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
lung cancer 4,466

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.600 0.001
diabetes mellitus 1.600 0.001

Synonym

Accession P43361 Q9BUN9
Symbols CT1.8
MAGE8

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASS      1 - 70
SLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLE     71 - 140
SVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLG    141 - 210
MILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRA    211 - 280
LAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV                                    281 - 318
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10521804 1999 Quantitative evaluation of the expression of MAGE genes in tumors by limiting dilution of cDNA libraries.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.