Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.34
PubTator Score 7.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 1.0e-03
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.600 1.1e-03
lung cancer 1.600 1.0e-03

AA Sequence

MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASS      1 - 70
SLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLE     71 - 140
SVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLG    141 - 210
MILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRA    211 - 280
LAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV                                    281 - 318
//

Text Mined References (10)

PMID Year Title