Property Summary

NCBI Gene PubMed Count 50
PubMed Score 101.60
PubTator Score 104.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 1.5e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.35 2.2
Klinefelter's syndrome 56 3.845 1.9

Gene RIF (35)

AA Sequence

MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS      1 - 70
ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV     71 - 140
IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI    141 - 210
AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA    211 - 280
ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV                                     281 - 317
//

Text Mined References (55)

PMID Year Title