Property Summary

NCBI Gene PubMed Count 45
Grant Count 13
Funding $803,794.13
PubMed Score 96.38
PubTator Score 104.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (30)

PMID Text
26910052 the crystal structures of MAGE-A3 and MAGE-A4
26191258 CTAs (MAGE-A4, NY-ESO-1, MAGE-A10) were more likely expressed in patients with squamous cell carcinoma of the lung and when CTAs combined with CD133, they can be better prognostic factors.
24238058 Expression of MAGE-A4 may make immunotherapeutic intervention possible in selected patients with thyroid cancer.
23172894 Mage-A4 expression and serum identification is and potential therapeutic target in estrogen receptor negative breast cancer.
23124547 HLA class I loss in smokers or patients with the MAGE-A4 gene was a prognostic factors in non-small cell lung cancer .
22842486 MAGEA4 promotes growth by preventing cell cycle arrest and by inhibiting apoptosis mediated by the p53 transcriptional targets.
22653756 Detection of MAGE-4 transcripts in blood may help to predict the prognosis and monitoring of the response of HCV-infected hepatocellular carcinoma patients to therapy
22323448 Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma.
22134685 Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells.
21815906 novel HLA-A2-restricted T cell epitope derived from MAGE-4 was identified
More...

AA Sequence

MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS      1 - 70
ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV     71 - 140
IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI    141 - 210
AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA    211 - 280
ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV                                     281 - 317
//

Text Mined References (49)

PMID Year Title
26910052 2016 Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
26191258 2015 Predictive and prognostic effect of CD133 and cancer-testis antigens in stage Ib-IIIA non-small cell lung cancer.
24238058 2013 Potential role of 5-aza-2'-deoxycytidine induced MAGE-A4 expression in immunotherapy for anaplastic thyroid cancer.
23172894 2013 Proteomic profiling of triple-negative breast carcinomas in combination with a three-tier orthogonal technology approach identifies Mage-A4 as potential therapeutic target in estrogen receptor negative breast cancer.
23124547 2013 Clinical significance of human leukocyte antigen loss and melanoma-associated antigen 4 expression in smokers of non-small cell lung cancer patients.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
22842486 2012 MAGEA4 induces growth in normal oral keratinocytes by inhibiting growth arrest and apoptosis.
22653756 2012 MAGE-4 gene m-RNA and TGF in blood as potential biochemical markers for HCC in HCV-infected patients.
22323448 2012 Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma.
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
More...