Property Summary

NCBI Gene PubMed Count 68
Grant Count 108
R01 Count 37
Funding $12,725,091.39
PubMed Score 301.99
PubTator Score 275.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 5.263 2.6

Synonym

Accession P43357 Q6FHI6
Symbols HIP8
HYPD
CT1.3
MAGE3
MAGEA6

Gene

PANTHER Protein Class (1)

PDB

1QEW   5BRZ   4V0P  

Gene RIF (53)

PMID Text
26910052 the crystal structures of MAGE-A3 and MAGE-A4
26612451 Progression free survival and levels of MAGE-A3 expression in non-small cell lung carcinoma patients with the three modes of acquired resistance are negatively correlated.
25704851 Anticancer effects of adenovirus-mediated calreticulin and melanoma-associated antigen 3 expression on non-small cell lung cancer cells
25679763 Study describes a widespread mechanism to suppress AMPK through its ubiquitination and degradation by the cancer-specific MAGE-A3/6-TRIM28 ubiquitin ligase. MAGE-A3 and MAGE-A6 are highly similar proteins normally expressed only in the male germline but frequently re-activated in human cancers.
25564441 MAGEA3/6 positivity was associated with significantly better disease-free survival.
25120790 MAGE-A3 may serve as a potential prognostic marker for clear cell renal cell carcinoma
25107531 MAGE proteins bind to KAP1, a gene repressor and ubiquitin E3 ligase which also binds KRAB domain containing zinc finger transcription factors (KZNFs), and MAGE expression may affect KZNF mediated gene regulation.
25031712 our findings indicated that MAGE-A3 is a novel cancer stem cell antigen in bladder cancer
24675493 Study demonstrated that the expression of MAGE-A3/4 antigen might be a valuable prognostic factor regarding survival in patients with NSCLC.
23728352 Data indicate that MAGE3, Survivin and B-cell maturation antigen (BCMA) mRNA-pulsed dendritic cells (DCs) are capable of stimulating tumor-associated antigens (TAA)-specific T-cell responses in multiple myeloma (MM) patients.
More...

AA Sequence

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS      1 - 70
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVV     71 - 140
GNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIA    141 - 210
REGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVE    211 - 280
TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE                                        281 - 314
//

Text Mined References (71)

PMID Year Title
26910052 2016 Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
26612451 2015 Evaluation of melanoma antigen gene A3 expression in drug resistance of epidermal growth factor receptor-tyrosine kinase inhibitors in advanced nonsmall cell lung cancer treatment.
25704851 2015 Anticancer effects of adenovirus-mediated calreticulin and melanoma-associated antigen 3 expression on non-small cell lung cancer cells.
25679763 2015 Degradation of AMPK by a cancer-specific ubiquitin ligase.
25564441 2015 A Comprehensive Expression Analysis of Cancer Testis Antigens in Head and Neck Squamous Cell Carcinoma Revels MAGEA3/6 as a Marker for Recurrence.
25120790 2014 Expression and clinical significance of cancer-testis genes in clear cell renal cell carcinoma.
25107531 2014 MAGE proteins regulate KRAB zinc finger transcription factors and KAP1 E3 ligase activity.
25031712 2014 MAGE-A3 is highly expressed in a cancer stem cell-like side population of bladder cancer cells.
24675493 Clinical significance of immunohistochemical expression of cancer/testis tumor-associated antigens (MAGE-A1, MAGE-A3/4, NY-ESO-1) in patients with non-small cell lung cancer.
23728352 2013 Immunogenicity of dendritic cells pulsed with MAGE3, Survivin and B-cell maturation antigen mRNA for vaccination of multiple myeloma patients.
More...