Property Summary

NCBI Gene PubMed Count 68
PubMed Score 301.99
PubTator Score 275.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 5.263 2.6

Synonym

Accession P43357 Q6FHI6
Symbols HIP8
HYPD
CT1.3
MAGE3
MAGEA6

Gene

PANTHER Protein Class (1)

PDB

1QEW   5BRZ   4V0P  

Gene RIF (53)

PMID Text
26910052 the crystal structures of MAGE-A3 and MAGE-A4
26612451 Progression free survival and levels of MAGE-A3 expression in non-small cell lung carcinoma patients with the three modes of acquired resistance are negatively correlated.
25704851 Anticancer effects of adenovirus-mediated calreticulin and melanoma-associated antigen 3 expression on non-small cell lung cancer cells
25679763 Study describes a widespread mechanism to suppress AMPK through its ubiquitination and degradation by the cancer-specific MAGE-A3/6-TRIM28 ubiquitin ligase. MAGE-A3 and MAGE-A6 are highly similar proteins normally expressed only in the male germline but frequently re-activated in human cancers.
25564441 MAGEA3/6 positivity was associated with significantly better disease-free survival.
25120790 MAGE-A3 may serve as a potential prognostic marker for clear cell renal cell carcinoma
25107531 MAGE proteins bind to KAP1, a gene repressor and ubiquitin E3 ligase which also binds KRAB domain containing zinc finger transcription factors (KZNFs), and MAGE expression may affect KZNF mediated gene regulation.
25031712 our findings indicated that MAGE-A3 is a novel cancer stem cell antigen in bladder cancer
24675493 Study demonstrated that the expression of MAGE-A3/4 antigen might be a valuable prognostic factor regarding survival in patients with NSCLC.
23728352 Data indicate that MAGE3, Survivin and B-cell maturation antigen (BCMA) mRNA-pulsed dendritic cells (DCs) are capable of stimulating tumor-associated antigens (TAA)-specific T-cell responses in multiple myeloma (MM) patients.
22925930 Cells bearing either intermediate proteasome present peptides MAGE-A(3114-122) and MAGE-C2(42-50) as efficiently as cells equipped with the immunoproteasome.
22498264 the expression of MAGE, as confirmed in the RT-PCR analysis, could be used as an alternative method for the early diagnosis of salivary gland tumours.
22323448 Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma.
22183072 Data indicate the association of MAGE-A3 expression and poor prognosis in diffuse large B-cell lymphoma (DLBCL) patients.
22134685 Report MAGEA1-A6 expression and MAGE A3 methylation in sputum suggests presence of lung cancer cells or precancerous cells.
21876767 Expression of MAGE I proteins, MAGE-A3 or MAGE-C2, relieved repression of a reporter gene by ZNF382 and MAGE I expression relieved KAP1 mediated ID1 repression.
21804405 MAGE-A3 gene may have a clinical relevance and important role as a risk factor in the development of acute myeloid leukemia
21565982 MAGE-A3 was detected in a significantly higher percentage of relapsed patients compared with newly diagnosed, establishing a novel correlation with progression of disease.
21556122 Primary tumors with and without lymph node metastases showed no significant differences in MAGE-A 3/4 (P=0.672) and NY-ESO-1 (P=0.444) expression
21452042 High MAGE-3 gene expression is associated with metastases in hepatitis C virus patients complicated by hepatocellular carcinoma.
21347689 we found that the SSX4 and MAGE-A3 genes are frequently expressed in brain tumor cell lines
21273595 MAGE3 expression mediated by demethylation of MAGE3 promoter induce progression of non-small cell lung cancer.
21264495 RT-PCR assays of MAGE-A3 and MAGE-A4 in blood of breast cancer (BC) patients may have prognostic and predictive implications, and they are promising specific tumor markers of BC
21135695 Molecular upstaging of MAGE-A3 using rt-pcr was correlated with prognosis in melanoma patients
20591578 Report immunohistochemical expression of MAGE-A3 in renal oncocytoma and chromophobe renal cell carcinoma.
20423514 Tumor-specific antigen MAGE may play a role in the occurrence and development of ovarian cancer and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer.
20036422 results showed that MAGE-A3 gene expression was frequent in NHL patients and decreased after effective chemotherapy, suggesting that MAGE-A3 can be used as a tumor marker for circulating lymphoma cells in patients with NHL.
20015885 MAGE-A3, a cancer-testis antigen, plays an important role in the survival of multiple myeloma cells.
19795170 MAGE-A3/6 and NY-ESO-1 were expressed in 50.0% (66/132) and 18.2% (24/132) of non-small-cell lung carcinomas, respectively.
19326132 In stage III melanomas the expression of MAGE-3, either alone or in association with the expression of other tumour-specific antigens at a transcriptional level, is a good prognostic factor for higher disease-free survival.
19261683 Increase in cytoplasmic MAGEA3 is associated with thyroid cancer.
18982744 Its expression is significantly associated with prognostic factors in poor outcome of the non-small cell lung cancer
18976975 Knockdown of melanoma antigen family A, 3 (MAGEA3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18829569 MAGE A3 is a functional integrator of diverse signals, including FGFR2 and FN, to modulate cancer progression.
18505125 The high expression rates of MAGE-1 and MAGE-3 genes in IHCC suggests the MAGE-1 and MAGE-3 gene may be a target for immunotherapy in IHCC patients.
18483279 MAGE-A3 may have a role in melanoma and could be used in a therapeutic vaccine
18381936 MAGE-A3 as a target of FGFR2-IIIb and estrogen action and provide evidence for a common histone-modifying network in the control of the balance between opposing signals.
18316621 the repertoire of MAGE-A3 epitopes recognized in vivo by CD4+ T cells are influenced by endosomal proteases
18237105 MAGEC1/CT7, MAGEA3/6 and LAGE-1 are good candidates for immunotherapy, since together they cover 85% of our MM cases.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
18181974 Measurement of Melan-A, gp100, MAGE-3, MIA and tyrosinase represents a prognostic factor and a method for early detection of metastasis and treatment response of melanoma patients.
17699848 Gene expression profiling identified the cancer/testis antigen MAGE-A3/6 as a novel target of FGFR2-IIIb signaling.
17634428 These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes.
17495964 the MAGE-A3 and MAGE-C2 gene promoter regions are de-methylated in the presence of activated KIT but become methylated on inhibition of KIT, consistent with the downregulation of mRNA and protein
17007017 The promoter hypomethylation of MAGE-A1 and MAGE-A3 genes up-regulates their expression in colorectal carcinomas as well as in gastric cancers and might play a significant role in the development and progression of human colorectal carcinomas.
16806467 MAGE-A3 gene mRNA is expressed at the mRNA level in a proportion of human leukemias.
16516880 Detection of aberrant methylation patterns of MAGEs CpG islands using Methylation-special PCR may be useful for diagnosis of Hepatocellular Carcinoma.
16446550 The newly identified MAGE-3(113)-peptide epitope is naturally processed and presented as the CTL epitope on MAGE-3-expressing GI cancer cells, indicating that anti-MAGE-3 immune targeting with the MAGE-3(113) peptide is a promising approach for treatment.
16114059 Present, by immunocytochemistry, in normal prostate, prostatic hypertrophy and prostate cancer.
15885805 first evidence that the naturally processed MAGE-3(271-279) can be isolated and identified from the tumor tissue of hepatocellular carcinoma patient
14672620 Spontaneous in vivo priming of MAGE-specific T cell response and high frequency of MAGE1 and MAGE3 expression in hepatocellular carcinoma makes this antigen potential candidate for MAGE-specific immunotherapy in hepatocellular carcinoma.
12710945 This melanoma-associated marker was detected in melanoma cell lines.
12393675 Identification of immunodominant regions among promiscuous HLA-DR-restricted CD4+ T-cell epitopes on the tumor antigen MAGE-3

AA Sequence

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS      1 - 70
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVV     71 - 140
GNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIA    141 - 210
REGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVE    211 - 280
TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE                                        281 - 314
//

Text Mined References (71)

PMID Year Title
26910052 2016 Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
26612451 2015 Evaluation of melanoma antigen gene A3 expression in drug resistance of epidermal growth factor receptor-tyrosine kinase inhibitors in advanced nonsmall cell lung cancer treatment.
25704851 2015 Anticancer effects of adenovirus-mediated calreticulin and melanoma-associated antigen 3 expression on non-small cell lung cancer cells.
25679763 2015 Degradation of AMPK by a cancer-specific ubiquitin ligase.
25564441 2015 A Comprehensive Expression Analysis of Cancer Testis Antigens in Head and Neck Squamous Cell Carcinoma Revels MAGEA3/6 as a Marker for Recurrence.
25120790 2014 Expression and clinical significance of cancer-testis genes in clear cell renal cell carcinoma.
25107531 2014 MAGE proteins regulate KRAB zinc finger transcription factors and KAP1 E3 ligase activity.
25031712 2014 MAGE-A3 is highly expressed in a cancer stem cell-like side population of bladder cancer cells.
24675493 Clinical significance of immunohistochemical expression of cancer/testis tumor-associated antigens (MAGE-A1, MAGE-A3/4, NY-ESO-1) in patients with non-small cell lung cancer.
23728352 2013 Immunogenicity of dendritic cells pulsed with MAGE3, Survivin and B-cell maturation antigen mRNA for vaccination of multiple myeloma patients.
22925930 2012 Analysis of the processing of seven human tumor antigens by intermediate proteasomes.
22498264 2012 Usefulness of the melanoma antigen gene (MAGE) in making the differential diagnosis between pleomorphic adenoma and adenoid cystic carcinoma.
22323448 2012 Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma.
22183072 2011 MAGE-A3 expression is an adverse prognostic factor in diffuse large B-cell lymphoma.
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
21876767 2011 MAGE I transcription factors regulate KAP1 and KRAB domain zinc finger transcription factor mediated gene repression.
21804405 2011 Melanoma antigen encoding gene-A3 expression, its clinical significance, and its risk of developing acute myeloid leukemia.
21565982 2011 MAGE-A inhibits apoptosis in proliferating myeloma cells through repression of Bax and maintenance of survivin.
21556122 2011 MAGE-A3/4 and NY-ESO-1 antigens expression in metastatic esophageal squamous cell carcinoma.
21452042 2012 MAGE-3 and MAGE-4 genes as possible markers for early detection of metastases in hepatitis C virus Egyptian patients complicated by hepatocellular carcinoma.
21347689 2011 Identification and functional characterization of glioma-specific promoters and their application in suicide gene therapy.
21277283 2011 Identification of novel small molecules that inhibit protein-protein interactions between MAGE and KAP-1.
21273595 2011 MAGE expressions mediated by demethylation of MAGE promoters induce progression of non-small cell lung cancer.
21264495 2011 The melanoma-associated antigen-A3, -A4 genes: relation to the risk and clinicopathological parameters in breast cancer patients.
21135695 2011 Molecular upstaging based on paraffin-embedded sentinel lymph nodes: ten-year follow-up confirms prognostic utility in melanoma patients.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
20591578 2010 Immunohistochemical expression of tumor antigens MAGE-A3/4 and NY-ESO-1 in renal oncocytoma and chromophobe renal cell carcinoma.
20423514 2010 Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.
20036422 2010 Detection of circulating lymphoma cells in patients with non-Hodgkin lymphoma using MAGE-A3 gene expression in peripheral blood.
20015885 2010 Cancer-testis antigens MAGE-C1/CT7 and MAGE-A3 promote the survival of multiple myeloma cells.
19795170 Expression of cancer-testis antigens MAGE-A3/6 and NY-ESO-1 in non-small-cell lung carcinomas and their relationship with immune cell infiltration.
19326132 2009 Melanoma gene expression and clinical course.
19261683 2009 Expression of the melanoma-associated antigen is associated with progression of human thyroid cancer.
18982744 2008 Immunohystochemical expression of cancer/testis antigens (MAGE-A3/4, NY-ESO-1) in non-small cell lung cancer: the relationship with clinical-pathological features.
18829569 2008 The melanoma-associated antigen A3 mediates fibronectin-controlled cancer progression and metastasis.
18505125 2008 [Expression of melanoma antigen-1, 3 genes in human intrahepatic cholangiocarcinoma and its clinical significance].
18483279 2008 Functions of Anti-MAGE T-cells induced in melanoma patients under different vaccination modalities.
18381936 2008 Fibroblast growth factor 2 and estrogen control the balance of histone 3 modifications targeting MAGE-A3 in pituitary neoplasia.
18316621 2008 Endosomal proteases influence the repertoire of MAGE-A3 epitopes recognized in vivo by CD4+ T cells.
18237105 2008 Prognostic impact of cancer/testis antigen expression in advanced stage multiple myeloma patients.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
18181974 2008 Multimarker real-time reverse transcription-PCR for quantitative detection of melanoma-associated antigens: a novel possible staging method.
17942928 2007 MAGE-A, mMage-b, and MAGE-C proteins form complexes with KAP1 and suppress p53-dependent apoptosis in MAGE-positive cell lines.
17699848 2007 The cancer/testis antigen melanoma-associated antigen-A3/A6 is a novel target of fibroblast growth factor receptor 2-IIIb through histone H3 modifications in thyroid cancer.
17634428 2007 Methyl-CpG binding domain proteins and their involvement in the regulation of the MAGE-A1, MAGE-A2, MAGE-A3, and MAGE-A12 gene promoters.
17495964 2007 Epigenetic control of MAGE gene expression by the KIT tyrosine kinase.
17007017 2006 Promoter hypomethylation and reactivation of MAGE-A1 and MAGE-A3 genes in colorectal cancer cell lines and cancer tissues.
16806467 2007 mRNA expression of MAGE-A3 gene in leukemia cells.
16516880 2006 5' CpG island methylation analysis identifies the MAGE-A1 and MAGE-A3 genes as potential markers of HCC.
16446550 2006 A newly identified MAGE-3-derived, HLA-A24-restricted peptide is naturally processed and presented as a CTL epitope on MAGE-3-expressing gastrointestinal cancer cells.
16114059 2006 Immunohistochemical expression of tumor antigens MAGE-A1, MAGE-A3/4, and NY-ESO-1 in cancerous and benign prostatic tissue.
15885805 2005 Identification of two naturally presented MAGE antigenic peptides from a patient with hepatocellular carcinoma by mass spectrometry.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672620 2004 Ex vivo characterization of tumor-derived melanoma antigen encoding gene-specific CD8+cells in patients with hepatocellular carcinoma.
12710945 2003 Detection of multiple melanoma-associated markers in melanoma cell lines by RT in situ PCR.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393675 2003 Identification of immunodominant regions among promiscuous HLA-DR-restricted CD4+ T-cell epitopes on the tumor antigen MAGE-3.
12097332 2002 An endoplasmic reticulum stress-specific caspase cascade in apoptosis. Cytochrome c-independent activation of caspase-9 by caspase-12.
11691819 2001 Activation of melanoma antigen tumor antigens occurs early in lung carcinogenesis.
10854409 2000 Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
9044853 1997 Analysis of MAGE-3-specific cytolytic T lymphocytes in human leukocyte antigen-A2 melanoma patients.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8113684 1994 Human gene MAGE-3 codes for an antigen recognized on a melanoma by autologous cytolytic T lymphocytes.
8037761 1994 Cloning and analysis of MAGE-1-related genes.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.
7757970 1995 Identification and intracellular location of MAGE-3 gene product.
7591235 1995 Expression of MAGE genes in primary and metastatic cutaneous melanoma.
1840703 1991 A gene encoding an antigen recognized by cytolytic T lymphocytes on a human melanoma.