Property Summary

NCBI Gene PubMed Count 25
PubMed Score 19.59
PubTator Score 14.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.721 1.9

Gene RIF (10)

AA Sequence

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQQTASSSSTLVEVTLGEVPAADSPSPPHSPQGASS      1 - 70
FSTTINYTLWRQSDEGSSNQEEEGPRMFPDLESEFQAAISRKMVELVHFLLLKYRAREPVTKAEMLESVL     71 - 140
RNCQDFFPVIFSKASEYLQLVFGIEVVEVVPISHLYILVTCLGLSYDGLLGDNQVMPKTGLLIIVLAIIA    141 - 210
IEGDCAPEEKIWEELSMLEVFEGREDSVFAHPRKLLMQDLVQENYLEYRQVPGSDPACYEFLWGPRALIE    211 - 280
TSYVKVLHHTLKIGGEPHISYPPLHERALREGEE                                        281 - 314
//

Text Mined References (28)

PMID Year Title