Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.52
PubTator Score 14.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.676 1.8
Peripheral Neuropathy 303

Synonym

Accession P43356 A8K328 Q32NC6
Symbols CT1.2
MAGE2
MAGEA2A

Gene

PANTHER Protein Class (1)

Gene RIF (9)

PMID Text
26001071 We find that MAGE-A2 interacts with MDM2 via the N-terminal p53-binding pocket and the RING finger domain of MDM2 that is required for homo/hetero-dimerization and for E2 ligase interaction.
24662835 MAGEA2 has a critical role in the development of tamoxifen-resistant breast cancer
24481586 Consistent with increased cell death, the induced loss of MAGEA2 expression correlated with increased caspase 3/7 activity, BCL2/BAX ratio and TUNEL signal.
22134685 Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells.
22117195 MageA2 interferes with p53 acetylation at PML-nuclear bodies (NBs) and with PMLIV-dependent activation of p53.
21422315 These data suggest that MAGEA2 is differentially expressed in HNSCC and functions, in part, through the p53 pathway by increasing cellular proliferation and abrogating cell cycle arrest.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
17634428 These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes.
16847267 MAGE-A2 targets p53 transactivation function through histone deacetylase recruitment

AA Sequence

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQQTASSSSTLVEVTLGEVPAADSPSPPHSPQGASS      1 - 70
FSTTINYTLWRQSDEGSSNQEEEGPRMFPDLESEFQAAISRKMVELVHFLLLKYRAREPVTKAEMLESVL     71 - 140
RNCQDFFPVIFSKASEYLQLVFGIEVVEVVPISHLYILVTCLGLSYDGLLGDNQVMPKTGLLIIVLAIIA    141 - 210
IEGDCAPEEKIWEELSMLEVFEGREDSVFAHPRKLLMQDLVQENYLEYRQVPGSDPACYEFLWGPRALIE    211 - 280
TSYVKVLHHTLKIGGEPHISYPPLHERALREGEE                                        281 - 314
//

Text Mined References (26)

PMID Year Title
26001071 2015 MAGE-A Cancer/Testis Antigens Inhibit MDM2 Ubiquitylation Function and Promote Increased Levels of MDM4.
24662835 2014 Identification of MAGEA antigens as causal players in the development of tamoxifen-resistant breast cancer.
24481586 2014 The adherens junction-associated protein 1 is a negative transcriptional regulator of MAGEA2, which potentiates temozolomide-induced apoptosis in GBM.
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
22117195 2012 MageA2 restrains cellular senescence by targeting the function of PMLIV/p53 axis at the PML-NBs.
21422315 2011 The role of MAGEA2 in head and neck cancer.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
17942928 2007 MAGE-A, mMage-b, and MAGE-C proteins form complexes with KAP1 and suppress p53-dependent apoptosis in MAGE-positive cell lines.
17634428 2007 Methyl-CpG binding domain proteins and their involvement in the regulation of the MAGE-A1, MAGE-A2, MAGE-A3, and MAGE-A12 gene promoters.
More...