Property Summary

NCBI Gene PubMed Count 55
Grant Count 27
R01 Count 6
Funding $1,195,632.19
PubMed Score 186.90
PubTator Score 202.83

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (29)

PMID Text
25590999 TRIM31 directly binds to NSE4, suggesting the existence of a TRIM31-MAGEA1-NSE4 complex reminiscent of the NSE1-NSE3-NSE4 trimer.
25363021 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
23472218 DNA methylation has a dominant role in the epigenetic hierarchy governing MAGEA1 expression
22447174 results show the absence and/or low expression of MAGE A1 transcripts in oral squamous cell carcinoma; presence of hypomethylation at a small level at the promoter site of MAGE A1 was detected in both oral squamous cell carcinoma and normal oral mucosa
22134685 Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells.
21273595 MAGE1 expression mediated by demethylation of MAGE1 promoter induce progression of non-small cell lung cancer.
21042944 High MAGE-1 is associated with differentiated advanced gastric cancer.
20862285 Observational study of gene-disease association. (HuGE Navigator)
20592351 MAGE-A peptides and HLA class I molecules are expressed in hepatocellular carcinoma
20423514 Tumor-specific antigen MAGE may play a role in the occurrence and development of ovarian cancerc and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer.
More...

AA Sequence

MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF      1 - 70
TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF     71 - 140
PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP    141 - 210
EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVL    211 - 280
EYVIKVSARVRFFFPSLREAALREEEEGV                                             281 - 309
//

Text Mined References (62)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25590999 2015 The melanoma-associated antigen 1 (MAGEA1) protein stimulates the E3 ubiquitin-ligase activity of TRIM31 within a TRIM31-MAGEA1-NSE4 complex.
25416956 2014 A proteome-scale map of the human interactome network.
25363021 2014 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
23472218 2013 Epigenetic hierarchy within the MAGEA1 cancer-germline gene: promoter DNA methylation dictates local histone modifications.
22447174 2012 Evaluation of MAGE A1 in oral squamous cell carcinoma.
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
21364888 2011 Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.
21273595 2011 MAGE expressions mediated by demethylation of MAGE promoters induce progression of non-small cell lung cancer.
21269460 2011 Initial characterization of the human central proteome.
More...