Property Summary

NCBI Gene PubMed Count 65
PubMed Score 197.60
PubTator Score 202.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2890 3.2e-07
malignant mesothelioma 3232 2.9e-06
lung cancer 4740 7.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 5.081 2.5

Gene RIF (37)

AA Sequence

MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF      1 - 70
TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF     71 - 140
PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP    141 - 210
EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVL    211 - 280
EYVIKVSARVRFFFPSLREAALREEEEGV                                             281 - 309
//

Text Mined References (72)

PMID Year Title