Property Summary

Ligand Count 8
NCBI Gene PubMed Count 159
PubMed Score 415.39
PubTator Score 263.74

Knowledge Summary

Patent (24,403)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Parkinson's disease 392 6.178 3.1

Expression

  Differential Expression (35)

Disease log2 FC p
acute myeloid leukemia 2.100 2.2e-02
adrenocortical carcinoma -4.367 3.3e-10
adult high grade glioma -2.100 8.2e-03
astrocytoma -1.200 1.5e-09
atypical teratoid / rhabdoid tumor -2.200 1.5e-04
Barrett's esophagus 1.400 4.5e-02
Breast cancer 1.700 3.7e-02
chronic lymphosyte leukemia -1.500 7.2e-05
chronic rhinosinusitis -1.458 2.5e-02
ependymoma -2.200 1.3e-07
esophageal adenocarcinoma 1.100 3.6e-02
gastric cancer -1.500 3.6e-03
glioblastoma -2.300 3.5e-07
group 4 medulloblastoma -1.800 2.0e-02
hepatocellular carcinoma -2.800 3.2e-05
interstitial cystitis 1.300 4.4e-02
interstitial lung disease -2.600 3.4e-02
lung adenocarcinoma -1.242 9.1e-03
lung cancer -2.800 3.2e-04
medulloblastoma, large-cell -2.200 2.9e-03
nasopharyngeal carcinoma -1.200 2.6e-04
nephrosclerosis -1.020 6.0e-04
non-small cell lung cancer -2.634 2.0e-15
oligodendroglioma -1.300 5.2e-03
osteosarcoma 1.864 3.6e-02
pancreatic cancer -1.600 1.3e-03
pancreatic carcinoma -1.600 1.3e-03
pituitary cancer -4.800 5.3e-09
primitive neuroectodermal tumor -1.400 2.6e-02
psoriasis -2.500 6.3e-08
Rheumatoid arthritis 2.500 6.6e-03
tuberculosis -1.300 6.0e-04
ulcerative colitis 2.800 3.3e-05
urothelial carcinoma -1.700 4.6e-02
Waldenstrons macroglobulinemia 1.754 4.2e-02

Gene RIF (151)

AA Sequence

MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTG      1 - 70
YDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHS     71 - 140
PMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSH    141 - 210
HVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTC    211 - 280
EGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPK    281 - 350
SPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW    351 - 420
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFS    421 - 490
SNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLP    491 - 560
ELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF                                    561 - 598
//

Text Mined References (161)

PMID Year Title