Property Summary

NCBI Gene PubMed Count 147
Grant Count 160
R01 Count 92
Funding $11,886,893.36
PubMed Score 384.87
PubTator Score 263.74

Knowledge Summary

Patent (24,403)

Expression

  Differential Expression (35)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.007
nephrosclerosis -1.048 0.001
gastric cancer -1.700 0.003
hepatocellular carcinoma -3.000 0.000
pancreatic cancer -1.900 0.002
interstitial lung disease -3.000 0.029
Waldenstrons macroglobulinemia 3.172 0.007
urothelial carcinoma -1.700 0.046
oligodendroglioma -1.800 0.009
Barrett's esophagus 1.400 0.045
esophageal adenocarcinoma 1.400 0.031
astrocytoma -1.400 0.000
glioblastoma -2.800 0.000
osteosarcoma 1.864 0.036
chronic lymphosyte leukemia -1.500 0.000
ependymoma -2.300 0.000
group 4 medulloblastoma -1.800 0.020
atypical teratoid/rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -2.600 0.002
primitive neuroectodermal tumor -1.400 0.026
adrenocortical carcinoma -4.821 0.000
tuberculosis -1.500 0.003
non-small cell lung cancer -2.659 0.000
lung cancer -3.100 0.001
inflammatory breast cancer -1.800 0.000
interstitial cystitis 1.400 0.038
adult high grade glioma -2.700 0.003
pancreatic carcinoma -1.900 0.002
nasopharyngeal carcinoma -1.400 0.002
lung adenocarcinoma -1.242 0.009
psoriasis -2.800 0.000
acute myeloid leukemia 2.100 0.022
ulcerative colitis 3.000 0.000
pituitary cancer -4.800 0.000
chronic rhinosinusitis -1.601 0.024

Synonym

Accession P43354 Q16311 Q53RZ2 Q6NXU0
Symbols NOT
RNR1
HZF-3
NURR1
TINUR

Gene

PDB

1OVL  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (139)

PMID Text
26239742 decreased expression levels of Nurr1 were associated with chronic inflammation and insulin resistance in patients with T2D.
26148973 Data show that some rexinoids display selective coactivator (CoA) recruitment by the retinoid X receptors (RXRs) homodimer and by the heterodimers nuclear receptor Nur77/RXR and Nurr1/RXR.
26022133 The immunohistochemical, qRT-PCR and western blot analyses revealed that Nurr1 expression was increased in gastric cancer tissues compared with normal gastric tissue.
25982322 The results failed to reveal significant link between NR4A2 polymorphism and schizophrenia risk. [META-ANALYSIS]
25953901 Thus our data identify a previously unknown role for Nr4a2 in the regulation of macrophage polarization.
25917081 NR4A2 is a key factor in multiple diseases, such as inflammation, cancer and cardiovascular diseases.
25809189 A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M.
25752609 Because the phosphorylation site mutants of NR4A2 cannot rescue the cell death-promoting activity, ASK1-p38 pathway-dependent phosphorylation and subsequent cytoplasmic translocation of NR4A2 may be required for oxidative stress-induced cell death.
25503547 NURR1 upregulation by tissue-type plasminogen activator during ischemic stroke is associated with endothelial dysfunction and inflammation.
25199433 gestational diabetes mellitus, but not pre-existing maternal obesity, associated with increased placental expression
More...

AA Sequence

MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTG      1 - 70
YDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHS     71 - 140
PMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSH    141 - 210
HVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTC    211 - 280
EGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPK    281 - 350
SPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW    351 - 420
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFS    421 - 490
SNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLP    491 - 560
ELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF                                    561 - 598
//

Text Mined References (149)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26239742 2015 Decreased expression levels of Nurr1 are associated with chronic inflammation in patients with type 2 diabetes.
26148973 2015 Selective ligand activity at Nur/retinoid X receptor complexes revealed by dimer-specific bioluminescence resonance energy transfer-based sensors.
26022133 2015 Clinicopathological significance of orphan nuclear receptor Nurr1 expression in gastric cancer.
25982322 2015 Association between NR4A2 genetic variation and schizophrenia: A comprehensive systematic review and meta-analysis.
25953901 2015 Nuclear Receptor Nr4a2 Promotes Alternative Polarization of Macrophages and Confers Protection in Sepsis.
25917081 2016 Nuclear receptor 4A (NR4A) family - orphans no more.
25809189 2015 NR4A receptors up-regulate the antiproteinase alpha-2 macroglobulin (A2M) and modulate MMP-2 and MMP-9 in vascular smooth muscle cells.
25752609 2015 Apoptosis Signal-regulating Kinase 1 (ASK1)-p38 Pathway-dependent Cytoplasmic Translocation of the Orphan Nuclear Receptor NR4A2 Is Required for Oxidative Stress-induced Necrosis.
25503547 2015 NURR1 involvement in recombinant tissue-type plasminogen activator treatment complications after ischemic stroke.
More...