Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 16.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.087 5.4e-05
chronic rhinosinusitis -1.618 2.4e-02
intraductal papillary-mucinous adenoma (... 1.200 4.1e-04
lung adenocarcinoma -1.200 1.3e-06
lung cancer -2.400 6.0e-06
nasopharyngeal carcinoma -1.400 1.9e-07
non-small cell lung cancer -1.990 1.5e-17
osteosarcoma -2.166 1.7e-05
pancreatic ductal adenocarcinoma liver m... 1.014 4.0e-02
subependymal giant cell astrocytoma 1.437 5.1e-03
tuberculosis 1.300 1.6e-05

Gene RIF (10)

AA Sequence

MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGE      1 - 70
VTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPS     71 - 140
EISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLE    141 - 210
LGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSP    211 - 280
NLGRIINQKQFQRLRALLGCGRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDE    281 - 350
AIEFINRREKPLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFD    351 - 420
TFSHHRACLLRSPGMEKLNALRYPPQSPRRLRMLLVAMEAQGCSCTLL                          421 - 468
//

Text Mined References (19)

PMID Year Title