Property Summary

NCBI Gene PubMed Count 105
PubMed Score 621.98
PubTator Score 167.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis 1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.200 1.3e-03
malignant mesothelioma 1.200 2.8e-05
osteosarcoma -3.567 3.0e-07
psoriasis -3.300 3.1e-05

Protein-protein Interaction (1)

Gene RIF (86)

AA Sequence

MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHR      1 - 70
VINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLE     71 - 140
KARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRP    141 - 210
NMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVS    211 - 280
TPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD    281 - 350
PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS      351 - 418
//

Text Mined References (110)

PMID Year Title