Property Summary

NCBI Gene PubMed Count 97
Grant Count 236
R01 Count 147
Funding $24,437,774.85
PubMed Score 602.59
PubTator Score 167.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -3.300 0.000
osteosarcoma -3.567 0.000
Atopic dermatitis 1.100 0.001
intraductal papillary-mucinous adenoma (... 1.200 0.001

Synonym

Accession P43351 Q13205 Q9Y5T7 Q9Y5T8 Q9Y5T9
Symbols

Gene

PDB

1H2I   1KN0   5JRB  

 GWAS Trait (1)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
651660 screening 17 / 5 / 1871 FRET-based HTS for detection of RAD52 Inhibitors Measured in Biochemical System Using Plate Reader - 7018-01_Inhibitor_SinglePoint_HTS_Activity
651710 screening 1634 / 0 / 354250 FRET-based HTS for detection of RAD52 Inhibitors Measured in Biochemical System Using Plate Reader - 7018-01_Inhibitor_SinglePoint_HTS_Activity_Set2
652116 confirmatory 636 / 180 / 180 FRET-based HTS for detection of RAD52 Inhibitors Measured in Biochemical System Using Plate Reader - 7018-01_Inhibitor_Dose_CherryPick_Activity
743275 confirmatory 28 / 14 / 28 Effect of RAD 52 Inhibitors on Growth of CAPAN-1 Cells Measured in Cell-Based System Using Imaging - 7018-03_Inhibitor_Dose_DryPowder_Activity_Set2
743276 confirmatory 34 / 32 / 4 Effect of RAD 52 Inhibitors on Growth of CAPAN-1 Cells Measured in Cell-Based System Using Imaging - 7018-03_Inhibitor_Dose_DryPowder_Activity_Set3

Gene RIF (78)

PMID Text
26013599 Study discovered two cis-expression quantitative trait loci SNPs in the RAD52 gene that are associated with its expression and are also associated with lung squamous cell carcinomas (LUSC) risk.
25793373 these results implicate increased RAD52 expression in both genetic susceptibility and tumorigenesis of upper aerodigestive tract and lung squamous cell carcinoma tumors.
25395584 BRG1-RAD52 complex mediates the replacement of RPA with RAD51 on single-stranded DNA (ssDNA) to initiate DNA strand invasion. Loss of BRG1 results in a failure of RAD51 loading onto ssDNA, abnormal homologous recombination repair
25365323 We have demonstrated that Rad51 and Rad52 dependent homologous recombination is coupled to HSV-1 DNA replication.
25012956 RAD52 rs7963551 single nucleotide polymorphism was significantly associated with glioma risk.
24729511 This study found that only the RAD52 rs7963551 single nucleotide polymorphism was significantly associated with hepatitis B virus related - hepatocellular carcinoma risk.
24415301 Our data did not show association between LIG4 and RAD52 SNPs and SLE, its clinical manifestations or ethnicity in the tested population.
24204313 Our findings reveal a novel RAD52/MUS81-dependent mechanism that promotes cell viability and genome integrity in checkpoint-deficient cells, and disclose the involvement of MUS81 to multiple processes after replication stress
24047694 Nuclear/chromatin PTEN mediates DNA damage repair through interacting with and modulating the activity of Rad52.
23836560 RAD52 mutation is associated with leukemia.
More...

AA Sequence

MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHR      1 - 70
VINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLE     71 - 140
KARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRP    141 - 210
NMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVS    211 - 280
TPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD    281 - 350
PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS      351 - 418
//

Text Mined References (102)

PMID Year Title
26013599 2016 Functional characterization of RAD52 as a lung cancer susceptibility gene in the 12p13.33 locus.
25793373 2015 The 12p13.33/RAD52 locus and genetic susceptibility to squamous cell cancers of upper aerodigestive tract.
25395584 2015 BRG1 promotes the repair of DNA double-strand breaks by facilitating the replacement of RPA with RAD51.
25365323 2014 Rad51 and Rad52 are involved in homologous recombination of replicating herpes simplex virus DNA.
25012956 2014 A RAD52 genetic variant located in a miRNA binding site is associated with glioma risk in Han Chinese.
24729511 2015 Association of a functional RAD52 genetic variant locating in a miRNA binding site with risk of HBV-related hepatocellular carcinoma.
24415301 2014 LIG4 and RAD52 DNA repair genes polymorphisms and systemic lupus erythematosus.
24340529 Rad52 protein function study by fluorescence tagging.
24319145 2014 Human RECQ5 helicase promotes repair of DNA double-strand breaks by synthesis-dependent strand annealing.
24204313 2013 Survival of the replication checkpoint deficient cells requires MUS81-RAD52 function.
More...