Property Summary

NCBI Gene PubMed Count 21
PubMed Score 22.17
PubTator Score 45.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 4.79485802419386E-15
ependymoma 2514 7.55255768111083E-13
pilocytic astrocytoma 3086 4.40743453168155E-8
Duchenne muscular dystrophy 602 1.68342172346576E-7
pediatric high grade glioma 2712 2.05796076340824E-7
psoriasis 6685 1.20747752702591E-6
acute quadriplegic myopathy 1157 3.22464816875945E-6
atypical teratoid / rhabdoid tumor 4369 7.30034327728652E-6
sonic hedgehog group medulloblastoma 1482 1.27937378213512E-5
lung adenocarcinoma 2714 2.10725206410732E-5
ulcerative colitis 2087 3.02088464424647E-5
medulloblastoma, large-cell 6234 4.98181751979505E-5
osteosarcoma 7933 7.21694028288858E-5
lung cancer 4473 2.22449132986909E-4
ovarian cancer 8492 2.28106371964214E-4
Multiple myeloma 1328 5.56202914671925E-4
primitive neuroectodermal tumor 3031 6.71976174479763E-4
glioblastoma 5572 0.00221307590150989
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00491930148468839
subependymal giant cell astrocytoma 2287 0.00706652185779674
active Crohn's disease 918 0.0135641017794024
Breast cancer 3099 0.0260299803310367

Expression

Gene

PANTHER Protein Class (1)

  Ortholog (16)

Gene RIF (1)

PMID Text
18976975 Knockdown of signal sequence receptor, alpha (SSR1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEE      1 - 70
EDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTAL     71 - 140
PLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFM    141 - 210
YMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR    211 - 280
SVGSDE                                                                    281 - 286
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22314232 2012 Palmitoylated calnexin is a key component of the ribosome-translocon complex.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...