Property Summary

NCBI Gene PubMed Count 21
PubMed Score 22.48
PubTator Score 45.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.193 1.2e-02
acute quadriplegic myopathy 1.169 5.5e-06
adult high grade glioma 1.200 7.8e-05
Astrocytoma, Pilocytic 1.700 6.4e-08
atypical teratoid / rhabdoid tumor 1.600 7.3e-06
Breast cancer 3.000 2.6e-02
Duchenne muscular dystrophy 1.003 1.7e-07
ependymoma 1.500 7.6e-13
glioblastoma 1.400 5.8e-08
group 3 medulloblastoma 1.100 9.8e-03
lung adenocarcinoma 1.077 7.9e-06
lung cancer 1.600 2.2e-04
medulloblastoma, large-cell 1.600 5.0e-05
Multiple myeloma 1.872 5.6e-04
non-small cell lung cancer 1.205 4.8e-15
osteosarcoma 1.133 3.0e-02
ovarian cancer -1.300 7.1e-04
pancreatic ductal adenocarcinoma liver m... -2.196 4.9e-03
primitive neuroectodermal tumor 1.200 6.7e-04
psoriasis 1.100 1.2e-06
subependymal giant cell astrocytoma 1.605 7.1e-03
ulcerative colitis 1.100 3.0e-05

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEE      1 - 70
EDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTAL     71 - 140
PLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFM    141 - 210
YMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR    211 - 280
SVGSDE                                                                    281 - 286
//

Text Mined References (31)

PMID Year Title