Property Summary

NCBI Gene PubMed Count 24
Grant Count 4
R01 Count 4
Funding $159,300.6
PubMed Score 66.86
PubTator Score 39.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P43304 A8K4V0 B3KSA9 Q59FR1 Q9HAP9 GPD-M
Symbols GDH2
GPDM
mGPDH

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (6)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of glycerol-3-phosphate dehydrogenase 2 (GPD2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17886033 the up-regulation of mGPDH, due to a highly glycolytic environment, contributes to the overall increase in ROS generation and may result in the progression of prostate cancer
15967408 Overall, these data demonstrate that mGPDH is involved in maintaining a high rate of glycolysis and is an important site of electron leakage leading to ROS production in prostate cancer cells.
15456763 testis-specific promoter of mitochondrial GPDH
11243726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEF      1 - 70
DILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVRYLQKAIMKLDIEQYRMVKEA     71 - 140
LHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLYDLVAGSNCLKSSYVLSKSRALEHFPMLQKD    141 - 210
KLVGAIVYYDGQHNDARMNLAIALTAARYGAATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFD    211 - 280
VRAKCVINATGPFTDSVRKMDDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMT    281 - 350
IAGTTDTPTDVTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH    351 - 420
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKTHNLKAGPSRTVGLFLQGGKDWSPTLYIRLVQDYGLE    421 - 490
SEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYGIKEYACTAVDMISRRTRLAF    491 - 560
LNVQAAEEALPRIVELMGRELNWDDYKKQEQLETARKFLYYEMGYKSRSEQLTDRSEISLLPSDIDRYKK    561 - 630
RFHKFDADQKGFITIVDVQRVLESINVQMDENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSR    631 - 700
LAILMKTAEENLDRRVPIPVDRSCGGL                                               701 - 727
//

Text Mined References (27)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19011903 2009 Haploinsufficiency of the GPD2 gene in a patient with nonsyndromic mental retardation.
17886033 2007 Increased expression of mitochondrial glycerophosphate dehydrogenase and antioxidant enzymes in prostate cancer cell lines/cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...