Property Summary

NCBI Gene PubMed Count 75
Grant Count 107
R01 Count 73
Funding $7,498,322.92
PubMed Score 232.78
PubTator Score 154.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.347 0.003
glioblastoma 1.900 0.021
atypical teratoid / rhabdoid tumor 2.100 0.000
non-small cell lung carcinoma 1.600 0.000
lung adenocarcinoma 1.300 0.000
pediatric high grade glioma 1.500 0.011
psoriasis 1.100 0.000

Synonym

Accession P43268 A8K314 B7Z5J3 B7Z9J6 Q96AW9
Symbols E1AF
PEA3
E1A-F
PEAS3

Gene

PANTHER Protein Class (1)

PDB

4CO8   4UUV  

Gene RIF (58)

PMID Text
26452058 ACC1 and ACLY regulate the levels of ETV4 under hypoxia via increased alpha-ketoglutarate. These results reveal that the ACC1/ACLY-alpha-ketoglutarate-ETV4 axis is a novel means by which metabolic states regulate transcriptional output
26238631 PEA3-subgroup transcription factors are key players of the Met signaling integration involved in regulation of migration and invasiveness of tumor cells.
25595908 ETV4 overexpression is associated with prostate cancer aggressiveness.
25544710 Silencing of ETV4 suppresses invasion of prostate cancer cells by inhibiting the expression of uPA/uPAR as well as (MMP)-2 and MMP-9
25516649 Implicate Pea3 as a mediator of liver metastases in colorectal cancer.
25417701 molecular mechanism underlying DBC1 function in PEA3-mediated transcription involves inhibition of SIRT1 interaction with PEA3 and of SIRT1-mediated deacetylation of PEA3
25203299 developed a novel RNA in situ hybridization-based assay for the in situ detection of ETV1, ETV4, and ETV5 in formalin-fixed paraffin-embedded tissues from prostate needle biopsies, prostatectomy, and metastatic PCa specimens using RNA probes
24983502 PEA3 regulates OCT4 gene expression as a transcriptional activator
24694612 data suggest that polyomavirus enhancer activator 3 and epithelium-specific transcription factor-1 may play important roles in pluri potent and tumorigenic embryonic carcinoma cells.
24072701 Two members of the ETS (E-26) family (PEA3 and ELK-1) regulate the expression of miRNA-200b. PEA3 promotes the expression of miRNA-200b, and ELK-1 is a transcriptional repressor of miRNA-200b.
More...

AA Sequence

MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHFQETWLAEAQV      1 - 70
PDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKS     71 - 140
PAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQ    141 - 210
HQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYL    211 - 280
HTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVAL    281 - 350
LDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF    351 - 420
VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY          421 - 484
//

Text Mined References (80)

PMID Year Title
26452058 2015 ACLY and ACC1 Regulate Hypoxia-Induced Apoptosis by Modulating ETV4 via ?-ketoglutarate.
26238631 2015 PEA3 transcription factors are downstream effectors of Met signaling involved in migration and invasiveness of Met-addicted tumor cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25595908 2015 Specific and redundant activities of ETV1 and ETV4 in prostate cancer aggressiveness revealed by co-overexpression cellular contexts.
25544710 2015 Overexpression of ETV4 is associated with poor prognosis in prostate cancer: involvement of uPA/uPAR and MMPs.
25516649 2014 Pea3 expression promotes the invasive and metastatic potential of colorectal carcinoma.
25417701 2015 A positive role of DBC1 in PEA3-mediated progression of estrogen receptor-negative breast cancer.
25203299 2014 Novel RNA hybridization method for the in situ detection of ETV1, ETV4, and ETV5 gene fusions in prostate cancer.
24983502 2014 Transcriptional activation of OCT4 by the ETS transcription factor PEA3 in NCCIT human embryonic carcinoma cells.
24694612 2014 Differential expression of ETS family transcription factors in NCCIT human embryonic carcinoma cells upon retinoic acid-induced differentiation.
More...