Property Summary

NCBI Gene PubMed Count 51
Grant Count 64
R01 Count 46
Funding $5,431,223.58
PubMed Score 28.85
PubTator Score 54.66

Knowledge Summary

Patent (6,483)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis 2.000 0.000
osteosarcoma -1.105 0.015
non primary Sjogren syndrome sicca 1.100 0.024

Synonym

Accession P43250 O60541 Q13652
Symbols GPRK6

Gene

PDB

2ACX   3NYN   3NYO  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (21)

PMID Text
26718636 The expression of GRK6 mRNA and protein was significantly lower in hypopharyngeal squamous cell carcinoma than in corresponding adjacent non-tumor tissues. This was associated with aberrant methylation of the gene.
24510965 these results indicate that GRK6 complexes with AGS3-Galphai2 to regulate CXCR2-mediated leukocyte functions at different levels, including downstream effector activation, receptor trafficking, and expression at the cell membrane.
24412271 GRK6 plays a predominant role in phosphorylation of FFA receptor (FFA)4.
24302161 Our results imply that GRK6 may not play a role in the pathophysiology of schizophrenia among Han Chinese
23497290 Downregulation of GRK6 expression enhances CXCR4 signaling and promoted medulloblastoma cell migration.
23375037 results suggested that GRK6 overexpression plays an important role in hepatocellular carcinoma
21784156 A reduced cortical concentration of GRK6 in schizophrenia (resembling that in aging) may result in altered G protein-dependent signaling, thus contributing to prefrontal deficits in schizophrenia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQPIGRLLFREF      1 - 70
CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKD     71 - 140
LFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGK    141 - 210
MYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQ    211 - 280
AGFPEARAVFYAAEICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVG    281 - 350
YMAPEVVKNERYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLC    351 - 420
SQLLCKDPAERLGCRGGSAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDIEQFSTVKGVE    421 - 490
LEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWKGQPPAPPKKGLLQRLFSRQD    491 - 560
CCGNCSDSEEELPTRL                                                          561 - 576
//

Text Mined References (56)

PMID Year Title
26718636 2016 Aberrant GRK6 promoter methylation is associated with poor prognosis in hypopharyngeal squamous cell carcinoma.
24510965 2014 G Protein-coupled receptor kinase-6 interacts with activator of G protein signaling-3 to regulate CXCR2-mediated cellular functions.
24412271 2014 Mechanisms of homologous and heterologous phosphorylation of FFA receptor 4 (GPR120): GRK6 and PKC mediate phosphorylation of Thr³??, Ser³??, and Ser³?? in the C-terminal tail.
24302161 2014 Association study of common variants within the G protein-coupled receptor kinase 6 gene and schizophrenia susceptibility in Han Chinese.
23497290 2013 Growth factor receptor-Src-mediated suppression of GRK6 dysregulates CXCR4 signaling and promotes medulloblastoma migration.
23375037 2013 GRK6 expression in patients with hepatocellular carcinoma.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
21784156 2011 Reduced expression of G protein-coupled receptor kinases in schizophrenia but not in schizoaffective disorder.
20729810 2010 Molecular basis for activation of G protein-coupled receptor kinases.
More...