Property Summary

NCBI Gene PubMed Count 657
PubMed Score 1465.00
PubTator Score 1540.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Sebaceous adenoma 26
Abdominal Pain 98
Abnormality of the abdomen 14
Adenocarcinoma of duodenum 2
Anxiety 136
Anxiety disease 113
Attention deficit hyperactivity disorder 278
Autosomal recessive predisposition 1442
Axillary freckling 5
Basal cell carcinoma 54
Basal cell nevi 23
Benign digestive system neoplasms 2
Benign genitourinary tract neoplasm 2
Birthmark 35
Cafe au lait spots, multiple 17
Cafe-au-Lait Spots 37
Carcinoma of larynx 2
Colon diverticulum anatomic structure 15
Colorectal cancer 25
Colorectal cancer, hereditary nonpolyposis, type 1 1
Constipation 181
Death in early adulthood 24
Death in early childhood 82
Death in infancy 82
Depressive disorder 409
Diverticular disease of colon 15
Duodenal Cancer 2
Dyschezia 135
Epilepsy 792
Fatigue 182
Fibrous skin tumor of tuberous sclerosis 18
Gastrointestinal Hemorrhage 52
Glioma 74
Hematologic Neoplasms 22
Hereditary Nonpolyposis Colorectal Cancer 11
Hereditary Nonpolyposis Colorectal Neoplasms 8
Hyperpigmented macules 42
Increased gastric cancer 21
Intermittent migraine headaches 68
Intracranial hypertension 32
Irritation - emotion 68
Leukemia 104
Lymphoma 81
Malabsorption 82
Malignant genitourinary tract tumors 2
Malignant tumor of colon 19
Migraine Disorders 76
Muscle Hypertonia 88
Muscle hypotonia 571
Nausea and vomiting 97
Neuroblastoma 80
Neurofibromatosis 1 3
Rectal Neoplasms 18
Rhabdomyosarcoma 39
Sebaceous Adenocarcinoma 2
Seizures 596
Stomach Neoplasms 300
Torre-Muir syndrome 3
Turcot syndrome (disorder) 5
Weight decreased 103
breast carcinoma 1638
ependymoma 4679
glioblastoma 5792
medulloblastoma 720
ovarian neoplasm 99
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 6.247 3.1

Expression

  Differential Expression (13)

Disease log2 FC p
ovarian cancer 1.500 2.5e-04
acute myeloid leukemia -1.400 2.8e-02
atypical teratoid / rhabdoid tumor 1.100 9.3e-04
Breast cancer 1.900 4.8e-02
diabetes mellitus -1.100 1.1e-03
group 3 medulloblastoma 1.800 4.1e-05
lung adenocarcinoma 1.212 1.1e-04
lung cancer 1.400 4.6e-03
malignant mesothelioma 1.400 1.4e-06
medulloblastoma, large-cell 1.300 1.1e-05
nasopharyngeal carcinoma 1.200 1.7e-03
non-small cell lung cancer 1.686 2.0e-20
pituitary cancer 1.100 7.6e-05

Protein-protein Interaction (1)

Gene RIF (589)

AA Sequence

MAVQPKETLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPA      1 - 70
GAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNND     71 - 140
MSASIGVVGVKMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECVLPGGETAGDM    141 - 210
GKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAVLPEMENQVAVSSLSAVIKFLELL    211 - 280
SDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPL    281 - 350
MDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQA    351 - 420
LEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEK    421 - 490
KMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLN    491 - 560
EEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQG    561 - 630
RIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESA    631 - 700
EVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYI    701 - 770
ATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHV    771 - 840
IECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQ    841 - 910
LKAEVIAKNNSFVNEIISRIKVTT                                                  911 - 934
//

Text Mined References (704)

PMID Year Title