Property Summary

NCBI Gene PubMed Count 60
Grant Count 9
R01 Count 8
Funding $726,979.1
PubMed Score 49.31
PubTator Score 53.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (48)

PMID Text
26899464 A missense mutation in MATR3 was identified in myopathy patients undergoing a needle electromyography.
26528920 Our findings indicate that mutations in Matrin 3 that are associated with ALS and myopathy do not dramatically alter the normal localization of the protein or readily induce inclusion formation.
26493020 Its mutations strengthens the role of RNA metabolism in amyotrophic lateral sclerosis etiology.
26129669 Suppressing Matrin 3 powers a heightened and broader ZAP restriction of HIV-1 gene expression.
26129669 siRNA knockdown of MATR3 improves the ZAP-induced degradation of HIV-1 transcripts; MATR3 enhances HIV-1 replication
25948554 Three-dimensional mapping of the lamin A-matrin-3 interface showed that the LMNA truncating mutation Delta303, which lacks the matrin-3 binding domain, was associated with an increased distance between lamin A and matrin-3.
25771394 MATR3 mutation is identified to be a possible cause of amyotrophic lateral sclerosis.
25677933 This study shows a high risk of abnormal respiratory function with progressive worsening in MATR3 myopathy.
25599992 Nuclear matrix protein Matrin3 regulates alternative splicing and forms overlapping regulatory networks with PTB.
25574029 MATR3 gene disruption is associated with bicuspid aortic valve, aortic coarctation and patent ductus arteriosus.
More...

AA Sequence

MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGMSSSLNQQGAH      1 - 70
SALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSARDLDELSRYPEDKITPENLPQ     71 - 140
ILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQE    141 - 210
SGYYDRMDYEDDRLRDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIED    211 - 280
FHGLLPKGYPHLCSICDLPVHSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTN    281 - 350
PAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE    351 - 420
PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQ    421 - 490
KQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQ    491 - 560
GRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPDGKESPSDKKSKTDGSQKTESSTEGKEQEEK    561 - 630
SGEDGEKDTKDDQTEQEPNMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAV    631 - 700
KKDGSASAAAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENK    701 - 770
DDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE    771 - 840
RRQKKET                                                                   841 - 847
//

Text Mined References (80)

PMID Year Title
26899464 2016 Needle electromyography findings in patients with MATR3 mutation - A prospective study.
26528920 2015 Subcellular Localization of Matrin 3 Containing Mutations Associated with ALS and Distal Myopathy.
26493020 2016 Replication study of MATR3 in familial and sporadic amyotrophic lateral sclerosis.
26129669 2015 Nuclear matrix protein Matrin 3 is a regulator of ZAP-mediated retroviral restriction.
25948554 2015 Disruption of the lamin A and matrin-3 interaction by myopathic LMNA mutations.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25771394 2015 Mutational analysis of MATR3 in Taiwanese patients with amyotrophic lateral sclerosis.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25677933 2015 Impairment of respiratory function in late-onset distal myopathy due to MATR3 Mutation.
More...