Property Summary

NCBI Gene PubMed Count 144
Grant Count 159
R01 Count 112
Funding $13,132,011.15
PubMed Score 869.69
PubTator Score 658.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P43235 Q6FHS6
Symbols CTSO
PKND
PYCD
CTS02
CTSO1
CTSO2

Gene

PANTHER Protein Class (3)

PDB

1ATK   1AU0   1AU2   1AU3   1AU4   1AYU   1AYV   1AYW   1BGO   1BY8   1MEM   1NL6   1NLJ   1Q6K   1SNK   1TU6   1U9V   1U9W   1U9X   1VSN   1YK7   1YK8   1YT7   2ATO   2AUX   2AUZ   2BDL   2R6N   3C9E   3H7D   3KW9   3KWB   3KWZ   3KX1   3O0U   3O1G   3OVZ   4DMX   4DMY   4N79   4N8W   4X6H   4X6I   4X6J   4YV8   4YVA   5J94   7PCK  

Gene RIF (112)

PMID Text
26302400 elevated levels of CatK are closely associated with the presence of chronic heart failure and that the measurement of circulating CatK provides a noninvasive method of documenting and monitoring the extent of chronic heart failure
26241216 increased expression and activation in osteoarthritis cartilage
26219353 Matrix-metalloproteinase-9 is cleaved and activated by cathepsin K.
25809793 SDF-1alpha is involved in homing of CXCR4+ GSLCs and leukocytes and that cathepsin K and osteopontin are involved in the migration of GSLCs out of the niches
25725806 Sequence analysis of the patient's CTSK gene revealed homozygosity for a missense mutation (c.746T>C) in exon 6, which leads to amino change (p.Ile249Thr) in the mature CTSK protein
25662720 There is an increase in levels of CATK in type 1 Gaucher patients compared to the control group. In the patient group, CATK showed higher levels in patients with bone damage compared to those without it.
25626674 The study determined almost identical substrate specificities for cysteine cathepsins K, L and S.
25558848 Cathepsins in Rotator Cuff Tendinopathy: Identification in Human Chronic Tears and Temporal Induction in a Rat Model.
25422423 one cathepsin K molecule binds to collagen-bound glycosaminoglycans at the gap region and recruits a second protease molecule that provides an unfolding and cleavage mechanism for triple helical collagen
25356585 The presence of high levels of inactive proforms of cathepsin K in GBM tissues and cells indicate that in GBM the proteolytic/collagenolytic role is not its primary function but it plays rather a different yet unknown role.
More...

AA Sequence

MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHT      1 - 70
YELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCW     71 - 140
AFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESC    141 - 210
MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLA    211 - 280
VGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM                         281 - 329
//

Text Mined References (147)

PMID Year Title
26302400 2015 Increased Circulating Cathepsin K in Patients with Chronic Heart Failure.
26241216 2016 Increased expression and activation of cathepsin K in human osteoarthritic cartilage and synovial tissues.
26219353 2015 Matrix-metalloproteinase-9 is cleaved and activated by cathepsin K.
25809793 2015 CD133+ and Nestin+ Glioma Stem-Like Cells Reside Around CD31+ Arterioles in Niches that Express SDF-1?, CXCR4, Osteopontin and Cathepsin K.
25731711 2015 Dental Abnormalities Caused by Novel Compound Heterozygous CTSK Mutations.
25725806 2015 A Mutation in CTSK Gene in an Autosomal Recessive Pycnodysostosis Family of Chinese Origin.
25662720 2015 [Cathepsin K as a biomarker of bone involvement in type 1 Gaucher disease].
25626674 2015 Fast profiling of protease specificity reveals similar substrate specificities for cathepsins K, L and S.
25558848 2015 Cathepsins in Rotator Cuff Tendinopathy: Identification in Human Chronic Tears and Temporal Induction in a Rat Model.
25422423 2014 Structural basis of collagen fiber degradation by cathepsin K.
More...