Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.02
PubTator Score 8.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.400 1.9e-04
astrocytoma 1.600 9.7e-03
Astrocytoma, Pilocytic 2.200 5.0e-09
cystic fibrosis 1.240 4.3e-04
diabetes mellitus -1.100 1.5e-03
ependymoma 1.300 5.7e-08
glioblastoma 1.400 2.4e-04
lung cancer -2.800 4.5e-05
malignant mesothelioma -2.600 6.3e-08
Multiple myeloma 2.378 8.6e-04
non-small cell lung cancer -1.292 4.6e-14
oligodendroglioma 1.300 1.8e-02
osteosarcoma 1.253 2.2e-02
ovarian cancer -2.300 8.5e-09
primary Sjogren syndrome 1.100 2.2e-03

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MDVRALPWLPWLLWLLCRGGGDADSRAPFTPTWPRSREREAAAFRESLNRHRYLNSLFPSENSTAFYGIN      1 - 70
QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGA     71 - 140
VESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGS    141 - 210
HSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTG    211 - 280
STPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV                                 281 - 321
//

Text Mined References (11)

PMID Year Title