Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.80
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 2.378 0.001
malignant mesothelioma -2.600 0.000
oligodendroglioma 1.300 0.018
osteosarcoma 1.253 0.022
posterior fossa group B ependymoma 1.400 0.000
cystic fibrosis 1.240 0.000
astrocytoma 1.600 0.010
glioblastoma 1.400 0.000
non-small cell lung cancer -1.292 0.000
lung cancer -2.800 0.000
diabetes mellitus -1.100 0.002
adult high grade glioma 1.400 0.000
pilocytic astrocytoma 2.200 0.000
primary Sjogren syndrome 1.100 0.002
ovarian cancer -2.300 0.000

Synonym

Accession P43234
Symbols CTSO1

Gene

PANTHER Protein Class (3)

Gene RIF (1)

PMID Text
23009386 In this study, various molecular dynamics (MD) simulations of pro- and mature human cathepsins L and O were performed.

AA Sequence

MDVRALPWLPWLLWLLCRGGGDADSRAPFTPTWPRSREREAAAFRESLNRHRYLNSLFPSENSTAFYGIN      1 - 70
QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGA     71 - 140
VESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGS    141 - 210
HSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTG    211 - 280
STPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV                                 281 - 321
//

Text Mined References (9)

PMID Year Title
23009386 2012 Molecular insight into propeptide-protein interactions in cathepsins L and O.
19786962 2011 First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9790772 1998 Genomic structure and chromosomal localization of the human cathepsin O gene (CTSO).
7929457 1994 Human cathepsin O. Molecular cloning from a breast carcinoma, production of the active enzyme in Escherichia coli, and expression analysis in human tissues.
7805878 1995 Molecular cloning of human cathepsin O, a novel endoproteinase and homologue of rabbit OC2.