Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.80
PubTator Score 8.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.56107154333859E-14
pilocytic astrocytoma 3086 6.45991047769063E-9
ovarian cancer 8492 8.47996223980318E-9
posterior fossa group B ependymoma 1530 2.03157182597527E-8
malignant mesothelioma 3163 6.30268386537902E-8
lung cancer 4473 4.4905887194069E-5
adult high grade glioma 2148 1.89940613119672E-4
glioblastoma 5572 2.41423122035352E-4
cystic fibrosis 1670 4.34694092809265E-4
Multiple myeloma 1328 8.60506179653275E-4
diabetes mellitus 1663 0.00154390395833609
primary Sjogren syndrome 789 0.00224873334111741
astrocytoma 1493 0.0097333752651403
oligodendroglioma 2849 0.0175493682215998
osteosarcoma 7933 0.0219037846390042

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 2.378 0.001
malignant mesothelioma -2.600 0.000
oligodendroglioma 1.300 0.018
osteosarcoma 1.253 0.022
posterior fossa group B ependymoma 1.400 0.000
cystic fibrosis 1.240 0.000
astrocytoma 1.600 0.010
glioblastoma 1.400 0.000
non-small cell lung cancer -1.292 0.000
lung cancer -2.800 0.000
diabetes mellitus -1.100 0.002
adult high grade glioma 1.400 0.000
pilocytic astrocytoma 2.200 0.000
primary Sjogren syndrome 1.100 0.002
ovarian cancer -2.300 0.000

Synonym

Accession P43234
Symbols CTSO1

Gene

PANTHER Protein Class (3)

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
23009386 In this study, various molecular dynamics (MD) simulations of pro- and mature human cathepsins L and O were performed.

AA Sequence

MDVRALPWLPWLLWLLCRGGGDADSRAPFTPTWPRSREREAAAFRESLNRHRYLNSLFPSENSTAFYGIN      1 - 70
QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGA     71 - 140
VESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGS    141 - 210
HSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTG    211 - 280
STPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV                                 281 - 321
//

Text Mined References (9)

PMID Year Title
23009386 2012 Molecular insight into propeptide-protein interactions in cathepsins L and O.
19786962 2011 First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9790772 1998 Genomic structure and chromosomal localization of the human cathepsin O gene (CTSO).
7929457 1994 Human cathepsin O. Molecular cloning from a breast carcinoma, production of the active enzyme in Escherichia coli, and expression analysis in human tissues.
7805878 1995 Molecular cloning of human cathepsin O, a novel endoproteinase and homologue of rabbit OC2.