Property Summary

NCBI Gene PubMed Count 13
Grant Count 17
R01 Count 7
Funding $934,991.53
PubMed Score 210.30
PubTator Score 38.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.987 0.003
ulcerative colitis -2.300 0.000

Gene RIF (5)

PMID Text
25885898 Our results indicate that decreased expression of CA7 correlates with disease progression and predicts poor prognosis in CRC, especially for patients with early stage tumors.
23851572 native hCA VII can protect cells from oxidative damage by preventing the apoptosis cascade and that cysteines play a leading role in this process
20493921 conclude that the full-length CA VII is a predominant active form in human brain and also in other tissues. In addition to the brain, CA VII is expressed in several other organs including the stomach, duodenum, colon, liver, and skeletal muscle
15686895 these data furnish further evidence that hCA VII is the isozyme responsible for the anticonvulsant/antiepileptic activity of sulfonamides and sulfamates
15528236 GABAergic transmission is influenced by the neuronal expression of carbonic anhydrase cavii--REVIEW

AA Sequence

MTGHHGWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQV      1 - 70
DFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAP     71 - 140
DGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKCLLPASRHYWTYPGSLTTPPLSESVT    141 - 210
WIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA                    211 - 264
//

Text Mined References (20)

PMID Year Title
25885898 2015 Prognostic value of carbonic anhydrase VII expression in colorectal carcinoma.
23851572 2013 Human carbonic anhydrase VII protects cells from oxidative damage.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20493921 2010 Analysis of a shortened form of human carbonic anhydrase VII expressed in vitro compared to the full-length enzyme.
19206230 2009 Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.
19186056 2009 A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.
17705204 2007 Saccharin inhibits carbonic anhydrases: possible explanation for its unpleasant metallic aftertaste.
17314045 2007 Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.
17127057 2007 Carbonic anhydrase activators: L-Adrenaline plugs the active site entrance of isozyme II, activating better isoforms I, IV, VA, VII, and XIV.
16807956 2006 Carbonic anhydrase activators. Activation of isozymes I, II, IV, VA, VII, and XIV with l- and d-histidine and crystallographic analysis of their adducts with isoform II: engineering proton-transfer processes within the active site of an enzyme.
More...