Property Summary

NCBI Gene PubMed Count 31
Grant Count 19
R01 Count 10
Funding $1,981,042.09
PubMed Score 58.80
PubTator Score 127.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
23485643 CrAT turned out to be active towards some but not all the BCAAO intermediates tested and no activity was found with dicarboxylic acyl-CoA esters.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19553674 Data show that CrAT overexpression in primary human skeletal myocytes increased glucose uptake and attenuated lipid-induced suppression of glucose oxidation.
15099582 structure of a binary complex of human peroxisomal carnitine acetyltransferase and the substrate l-carnitine, refined to a resolution of 1.8; site-directed mutagenesis and kinetic characterization
12562770 The structure and reactions of this enzyme are examined.
12077440 the purification, crystallization and preliminary X-ray crystallographic studies of human carnitine acetyltransferase are reported
11001805 Human CPT1A, CPT1B, CPT2, CROT and CRAT are known to encode active carnitine acyltransferases. Earlier pfam annotations refer to the non-existing compound CARNITATE. In 2000 this has been changed to CARNITINE.

AA Sequence

MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLV      1 - 70
DEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAA     71 - 140
KLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQ    141 - 210
FFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQ    211 - 280
KSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPP    281 - 350
IVTLLDYVIEYTKKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKD    351 - 420
FPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEH    421 - 490
QKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKT    491 - 560
DCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQSHPRAKL        561 - 626
//

Text Mined References (35)

PMID Year Title
26154055 2015 Carnitine Acetyltransferase Mitigates Metabolic Inertia and Muscle Fatigue during Exercise.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24395925 2014 Obesity and lipid stress inhibit carnitine acetyltransferase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23485643 2013 Substrate specificity of human carnitine acetyltransferase: Implications for fatty acid and branched-chain amino acid metabolism.
22560225 2012 Muscle-specific deletion of carnitine acetyltransferase compromises glucose tolerance and metabolic flexibility.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
More...