Property Summary

NCBI Gene PubMed Count 105
Grant Count 14
R01 Count 9
Funding $1,377,087.23
PubMed Score 98.94
PubTator Score 380.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma -2.100 0.000
sonic hedgehog group medulloblastoma 3.500 0.001
medulloblastoma, large-cell 1.900 0.000
lung adenocarcinoma -1.500 0.000
pilocytic astrocytoma 1.400 0.012
lung carcinoma -2.000 0.000
non-small cell lung carcinoma -1.300 0.000
pituitary cancer 1.200 0.032
psoriasis -2.300 0.000

Gene RIF (69)

PMID Text
27096627 The study identified DCC as a differentially expressed gene and clustered meningiomas into DCC low expression (3 grade I and 3 grade II tumors), DCC medium expression (2 grade I and 1 grade II tumors), and DCC high expression (5 grade I tumors) groups.
26710849 Data suggest that, in response to netrin-1/netrin receptor (DCC) signaling, p120RasGAP is recruited to growth cones and supports axon outgrowth; p120RasGAP Src homology 2 domains exhibit scaffolding properties sufficient to support axon outgrowth.
26390996 By analyzing multiple myeloma-derived cell lines and patient-derived primary CD138-positive plasma cells ... authors show for the first time that transcriptional dysregulation of DCC is involved in the progression of plasma cell malignancy.
26345965 the transfected DCC gene can suppress cell proliferation and lead to downregulation of CEA expression in SW1116 cells.
25950802 NTN1-DCC pathway contains targets of FDA-approved drugs and may offer promise for guiding applied clinical research on preventive and therapeutic interventions for AMD
25881791 Signaling mechanism of the netrin-1 receptor DCC in axon guidance
25813273 DCC mutation correlated with fractionated mirroring in individuals with Congenital mirror movements
25575591 Data show that silencing ezrin-radixin-moesin (ERM) protein expression ablates deleted in colorectal carcinoma protein (DCC)-protein kinase A (PKA) interaction and specifically blocks netrin-induced PKA activity and phosphorylation.
24966904 Migration of CD166 positive progenitor cells to sites of cartilage damage may be directed by regulation of DCC/CREB signaling.
24808016 Three novel truncating mutations of DCC are associated with congenital mirror movements.
More...

AA Sequence

MENSLRCVWVPKLAFVLFGASLFSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVP      1 - 70
VIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPL     71 - 140
RFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQPGDIGIY    141 - 210
RCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVI    211 - 280
QLRSKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEF    281 - 350
ECTVSGKPVPTVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP    351 - 420
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVG    421 - 490
NLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTSPTSILITWEPPAYANGPVQG    491 - 560
YRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNVS    561 - 630
LEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMT    631 - 700
VNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAE    701 - 770
TVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDL    771 - 840
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGL    841 - 910
KPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAY    911 - 980
ILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVEHPDKM    981 - 1050
ANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVI   1051 - 1120
CTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVS   1121 - 1190
HSQSETQLGSKSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ   1191 - 1260
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEHSSSEEAPSRT   1261 - 1330
IPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVP   1331 - 1400
TAPEVSEESHKPTEDSANVYEQDDLSEQMASLEGLMKQLNAITGSAF                          1401 - 1447
//

Text Mined References (106)

PMID Year Title
27096627 2016 Microarray Expression Data Identify DCC as a Candidate Gene for Early Meningioma Progression.
26710849 2016 p120RasGAP Protein Mediates Netrin-1 Protein-induced Cortical Axon Outgrowth and Guidance.
26429648 2015 Misregulation of the dependence receptor DCC and its upstream lincRNA, LOC100287225, in colorectal cancer.
26390996 2015 Transcriptional dysregulation of the deleted in colorectal carcinoma gene in multiple myeloma and monoclonal gammopathy of undetermined significance.
26345965 2015 Influence of the DCC gene on proliferation and carcinoembryonic antigen expression in the human colorectal cancer cell line SW1116.
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
25950802 2015 Netrin-1 - DCC Signaling Systems and Age-Related Macular Degeneration.
25881791 2015 Signaling mechanism of the netrin-1 receptor DCC in axon guidance.
25813273 2015 Congenital mirror movements: phenotypes associated with DCC and RAD51 mutations.
25575591 2015 Anchoring of protein kinase A by ERM (ezrin-radixin-moesin) proteins is required for proper netrin signaling through DCC (deleted in colorectal cancer).
More...