Property Summary

NCBI Gene PubMed Count 83
Grant Count 64
R01 Count 30
Funding $8,708,959.62
PubMed Score 897.97
PubTator Score 99.48

Knowledge Summary

Patent (4,241)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.393 0.000
lung adenocarcinoma -1.200 0.000
severe asthma -1.600 0.000

Synonym

Accession P43119
Symbols IP
PRIPR

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (57)

PMID Text
26775637 cPGI2 generates via its cognate cell-surface receptor IP-R, converting white adipocytes to brite adipocytes.
25617843 these findings suggest that reduced IPR expression in DM2 platelets may contribute to platelet hyperactivity in humans with type 2 diabetes.
24886841 A total of 38 non-synonymous mutations were identified within the coding region of the hIP receptor, mapping to 36 distinct residues, including several mutations previously reported to affect the signaling of the hIP receptor.
24035274 Prostaglandin I2- Prostaglandin I2 receptor signaling regulates human Th17 and Treg cell differentiation.
23628440 The present report is the first to show an association between the A984C polymorphism of the IP gene and platelet activation in Japanese subjects.
23162015 IP receptor heteridimerization with thromboxane receptor facilitates receptor trafficking to membrane lipid rafts.
22969152 The hIP gene is directly regulated by cholesterol depletion, which occurs through binding of SREBP1a to a functional SRE within its core promoter.
22884631 IKEPP was also found to be expressed in vascular endothelial cells where it co-localizes and complexes with the hIP
22381139 these data provide critical insights into the transcriptional regulation of the human prostacyclin receptor gene within the vasculature, including during megakaryocytic differentiation
22380928 the IP receptor was expressed in blood vessels of renal cell carcinoma specimens, but not in glomerular vessels of normal renal tissue; findings suggest the IP receptor might maintain an angiogenic switch in the "on" state in tumor endothelial cells (TEC); suggest that the IP receptor is a TEC-specific marker and might be a useful therapeutic target
More...

AA Sequence

MADSCRNLTYVRGSVGPATSTLMFVAGVVGNGLALGILSARRPARPSAFAVLVTGLAATDLLGTSFLSPA      1 - 70
VFVAYARNSSLLGLARGGPALCDAFAFAMTFFGLASMLILFAMAVERCLALSHPYLYAQLDGPRCARLAL     71 - 140
PAIYAFCVLFCALPLLGLGQHQQYCPGSWCFLRMRWAQPGGAAFSLAYAGLVALLVAAIFLCNGSVTLSL    141 - 210
CRMYRQQKRHQGSLGPRPRTGEDEVDHLILLALMTVVMAVCSLPLTIRCFTQAVAPDSSSEMGDLLAFRF    211 - 280
YAFNPILDPWVFILFRKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLS    281 - 350
AWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC                                      351 - 386
//

Text Mined References (85)

PMID Year Title
26775637 2016 IP-receptor and PPARs trigger the conversion of human white to brite adipocyte induced by carbaprostacyclin.
25617843 Prostacyclin receptor expression on platelets of humans with type 2 diabetes is inversely correlated with hemoglobin A1c levels.
24886841 2014 High throughput mutagenesis for identification of residues regulating human prostacyclin (hIP) receptor expression and function.
24035274 2013 Prostaglandin I2-IP signalling regulates human Th17 and Treg cell differentiation.
23628440 2013 Effect of single nucleotide polymorphisms of the prostacyclin receptor gene on platelet activation in Japanese healthy subjects and patients with cerebral infarction.
23162015 2013 Heterodimerization with the prostacyclin receptor triggers thromboxane receptor relocation to lipid rafts.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22969152 2012 Regulation of the human prostacyclin receptor gene by the cholesterol-responsive SREBP1.
22884631 2012 Interaction of the human prostacyclin receptor and the NHERF4 family member intestinal and kidney enriched PDZ protein (IKEPP).
22381139 2012 Regulation of the human prostacyclin receptor gene in megakaryocytes: major roles for C/EBP? and PU.1.
More...