Property Summary

Ligand Count 67
NCBI Gene PubMed Count 87
PubMed Score 912.24
PubTator Score 99.48

Knowledge Summary

Patent (4,241)


  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.200 4.8e-06
osteosarcoma 1.393 9.4e-07
severe asthma -1.600 3.3e-07

 CSPA Cell Line (3)

Gene RIF (61)

AA Sequence

AWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC                                      351 - 386

Text Mined References (89)

PMID Year Title