Property Summary

NCBI Gene PubMed Count 123
Grant Count 271
R01 Count 145
Funding $24,140,427.61
PubMed Score 15.11
PubTator Score 271.00

Knowledge Summary

Patent (38,554)

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.046
malignant mesothelioma -5.400 0.000
osteosarcoma -3.007 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.047
interstitial cystitis 1.100 0.004
lung carcinoma -1.900 0.000
ovarian cancer 1.500 0.011
Breast cancer 1.900 0.026

Synonym

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
940 screening 2162 / 0 / 259881 Modulators of the EP2 prostaglandin E2 receptor - Primary Screening
1080 other 637 / 0 / 707 Modulators of the EP2 prostaglandin EP2 receptor - Primary Counterscreens
1421 confirmatory 140 / 0 / 1204 Modulators of the EP2 prostaglandin EP2 receptor - Primary Dose Response
1422 screening 1326 / 0 / 255432 Inhibitors of the EP2 Prostaglandin E2 Receptor - Primary Screen
743167 confirmatory 49 / 52 / 0 Extended Characterization of HPGD Inhibitors: PGE2 Assay in A549 Cells
743172 confirmatory 55 / 30 / 9 Extended Characterization of HPGD Inhibitors: PGE2 Assay in LNCaP Cells

Gene RIF (114)

PMID Text
27012192 that the expression of ERG in prostate cancer is linked to the expression of IL-6 mediated by the prostanoid receptor EP2
26560040 Altered expression of EP2 in patients with aspirin-exacerbated respiratory disease contributes to deficient induction of IL-1RI, reducing the capacity of IL-1beta to increase COX-2 and mPGES-1 expression, which results in low PGE2 production
26538827 mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes
26051534 Reduced EP2 receptor expression results in resistance to the antiproliferative effects of EP2 signaling in nasal polyp fibroblasts from subjects with AERD and support a role for EP2 signaling in the aberrant growth of nasal polyp tissue.
25828575 Intracellular EP2 prostanoid receptor promotes cancer-related phenotypes in PC3 prostate cancer cells.
25681680 EP2 receptors exhibit more constraints to mutations than DP receptors.
25634217 Overall, our results demonstrate that p53 is a negative regulator of aromatase in the breast and its inhibition by PGE2 provides a novel mechanism for aromatase regulation in obesity and breast cancer.
25329458 data show a protective role for the PGE2 receptors EP(2) and EP(4) following osmotic changes, through the reduction of human mast cell activity caused by calcium influx impairment and MAP kinase inhibition.
25059824 EP2/cAMP/protein kinase A pathway mediates the stimulatory effect of PGEs on angiogenesis essential for tissue injury healing via the induction of CREB activity and VEGF expression.
24980222 mediates inhibitory effect of Prostaglandin E2 on nasal fibroblast migration
More...

AA Sequence

MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVL      1 - 70
VTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGH     71 - 140
PYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVS    141 - 210
VLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPF    211 - 280
TIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQS    281 - 350
DASKQADL                                                                  351 - 358
//

Text Mined References (123)

PMID Year Title
27012192 2016 IL-6 Overexpression in ERG-Positive Prostate Cancer Is Mediated by Prostaglandin Receptor EP2.
26560040 2016 Low E-prostanoid 2 receptor levels and deficient induction of the IL-1?/IL-1 type I receptor/COX-2 pathway: Vicious circle in patients with aspirin-exacerbated respiratory disease.
26538827 2015 Downregulation of mPGES-1 Expression via EGR1 Plays an Important Role in Inhibition of Caffeine on PGE2 Synthesis of HBx(+) Hepatocytes.
26051534 2016 Impaired E Prostanoid2 Expression and Resistance to Prostaglandin E2 in Nasal Polyp Fibroblasts from Subjects with Aspirin-Exacerbated Respiratory Disease.
25828575 2015 Intracellular EP2 prostanoid receptor promotes cancer-related phenotypes in PC3 cells.
25681680 2015 Human EP2 prostanoid receptors exhibit more constraints to mutations than human DP prostanoid receptors.
25634217 2015 Prostaglandin E2 inhibits p53 in human breast adipose stromal cells: a novel mechanism for the regulation of aromatase in obesity and breast cancer.
25329458 2014 Prostaglandin E2 prevents hyperosmolar-induced human mast cell activation through prostanoid receptors EP2 and EP4.
25059824 2014 Novel mechanisms and signaling pathways of esophageal ulcer healing: the role of prostaglandin EP2 receptors, cAMP, and pCREB.
24980222 Inhibitory effect of prostaglandin E(2) on the migration of nasal fibroblasts.
More...