Property Summary

Ligand Count 100
NCBI Gene PubMed Count 129
PubMed Score 16.37
PubTator Score 271.00

Knowledge Summary

Patent (38,554)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.900 2.6e-02
interstitial cystitis 1.100 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.7e-02
lung carcinoma -1.900 7.0e-20
malignant mesothelioma -5.400 2.0e-09
osteosarcoma -3.007 4.2e-07
ovarian cancer 1.500 1.1e-02
Rheumatoid arthritis 1.100 4.6e-02

Gene RIF (120)

AA Sequence

MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVL      1 - 70
VTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGH     71 - 140
PYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVS    141 - 210
VLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPF    211 - 280
TIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQS    281 - 350
DASKQADL                                                                  351 - 358
//

Text Mined References (129)

PMID Year Title