Property Summary

NCBI Gene PubMed Count 85
PubMed Score 604.10
PubTator Score 178.56

Knowledge Summary

Patent (25,624)


  Disease Sources (5)

Disease Target Count P-value
periodontitis 269 8.71836796385202E-20
ovarian cancer 8492 6.0237551304749E-16
intraductal papillary-mucinous adenoma (IPMA) 2956 2.23939893818556E-7
posterior fossa group B ependymoma 1530 8.05243416441906E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.41829476036519E-6
atypical teratoid / rhabdoid tumor 4369 1.54612206375032E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.254642383718E-5
pilocytic astrocytoma 3086 8.70760675572679E-5
pediatric high grade glioma 2712 1.42207287088157E-4
glioblastoma 5572 2.02169608563563E-4
adrenocortical carcinoma 1427 2.35847677125414E-4
psoriasis 6685 5.5154117173859E-4
oligodendroglioma 2849 6.87337221733723E-4
ductal carcinoma in situ 1745 7.42690932207814E-4
astrocytic glioma 2241 0.00119252358980339
invasive ductal carcinoma 2950 0.00122536693842675
colon cancer 1475 0.00191787821532095
pituitary cancer 1972 0.00588738809094995
Atopic dermatitis 944 0.0074105504324619
medulloblastoma 1524 0.00986470009590455
aldosterone-producing adenoma 664 0.0141758817100648
gastric carcinoma 832 0.016640042842617
medulloblastoma, large-cell 6234 0.0191358093490175
adrenocortical adenoma 134 0.0237712128551711
primitive neuroectodermal tumor 3031 0.0334359411664573
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0



Accession P43115 B0AZN4 B1AK19 B5BUP5 O00326 Q12943 Q12944 Q12945 Q16546 Q5CZ59 Q5CZ61 Q5CZ62 Q5CZ63 Q5CZ64 PGE receptor EP3 subtype
Symbols EP3


PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

 CSPA Cell Line (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (66)

26058972 The present study identified the functions of EP3 and the mechanisms by which PGE2 regulates beta-catenin expression and promoted cholangiocarcinoma cell growth and invasion
25333975 Our results show that oxLDL suppresses EP3 expression by activation of PPAR-g and subsequent inhibition of NF-kappaB in macrophages.
24180609 Failure of cervical ripening, after local application of prostaglandins for labor induction, may be caused by the increased expression of EP3 and concomitant decrease in EP4 expression.
23904482 Neuronal prostaglandin E2 receptor subtype EP3 mediates antinociception during inflammation.
23805813 results demonstrate that risk of unsuccessful periodontal treatment is associated with tag SNPs in specific genes that regulate the inflammatory response, one of which is also associated with sPTB.
23493387 EP3 downregulation contributed to prostate carcinogenesis and to progression from androgen-dependent prostate cancer to castration-resistant prostate cancer by regulating androgen receptor expression.
23406763 EP(3) receptors located postsynaptically strongly contract human pulmonary arteries.
23364535 Human prostate cancer is associated with EP4 and EP2 overexpression and reduced EP3 expression.
23349487 Prostaglandin E2 receptor, EP3, is induced in diabetic islets and negatively regulates glucose- and hormone-stimulated insulin secretion.
22915243 This study identify the PGE(2) EP3 receptor as a novel proinflammatory, proamyloidogenic, and synaptotoxic signaling pathway, and suggest a role for COX-PGE(2) -EP3 signaling in the development of AD.

AA Sequence

KILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER                                  351 - 390

Text Mined References (87)

PMID Year Title
26058972 2015 Prostaglandin E2 promotes human cholangiocarcinoma cell proliferation, migration and invasion through the upregulation of ?-catenin expression via EP3-4 receptor.
25333975 2014 Oxidized low-density lipoprotein suppresses expression of prostaglandin E receptor subtype EP3 in human THP-1 macrophages.
24180609 2014 The expression of prostaglandin receptors EP3 and EP4 in human cervix in post-term pregnancy differs between failed and successful labor induction.
23904482 2013 Neuronal prostaglandin E2 receptor subtype EP3 mediates antinociception during inflammation.
23805813 2014 Association of a common genetic factor, PTGER3, with outcome of periodontal therapy and preterm birth.
23493387 2013 Prostaglandin receptor EP3 mediates growth inhibitory effect of aspirin through androgen receptor and contributes to castration resistance in prostate cancer cells.
23406763 2012 EP? receptor-mediated contraction of human pulmonary arteries and inhibition of neurogenic tachycardia in pithed rats.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23364535 2013 Significance of divergent expression of prostaglandin EP4 and EP3 receptors in human prostate cancer.
23349487 2013 Prostaglandin E2 receptor, EP3, is induced in diabetic islets and negatively regulates glucose- and hormone-stimulated insulin secretion.