Property Summary

NCBI Gene PubMed Count 85
Grant Count 192
R01 Count 122
Funding $16,565,967.57
PubMed Score 604.10
PubTator Score 178.56

Knowledge Summary

Patent (25,624)

Expression

Synonym

Accession P43115 B0AZN4 B1AK19 B5BUP5 O00326 Q12943 Q12944 Q12945 Q16546 Q5CZ59 Q5CZ61 Q5CZ62 Q5CZ63 Q5CZ64 PGE receptor EP3 subtype
Symbols EP3
EP3e
EP3-I
EP3-II
EP3-IV
EP3-VI
PGE2-R
EP3-III

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (66)

PMID Text
26058972 The present study identified the functions of EP3 and the mechanisms by which PGE2 regulates beta-catenin expression and promoted cholangiocarcinoma cell growth and invasion
25333975 Our results show that oxLDL suppresses EP3 expression by activation of PPAR-g and subsequent inhibition of NF-kappaB in macrophages.
24180609 Failure of cervical ripening, after local application of prostaglandins for labor induction, may be caused by the increased expression of EP3 and concomitant decrease in EP4 expression.
23904482 Neuronal prostaglandin E2 receptor subtype EP3 mediates antinociception during inflammation.
23805813 results demonstrate that risk of unsuccessful periodontal treatment is associated with tag SNPs in specific genes that regulate the inflammatory response, one of which is also associated with sPTB.
23493387 EP3 downregulation contributed to prostate carcinogenesis and to progression from androgen-dependent prostate cancer to castration-resistant prostate cancer by regulating androgen receptor expression.
23406763 EP(3) receptors located postsynaptically strongly contract human pulmonary arteries.
23364535 Human prostate cancer is associated with EP4 and EP2 overexpression and reduced EP3 expression.
23349487 Prostaglandin E2 receptor, EP3, is induced in diabetic islets and negatively regulates glucose- and hormone-stimulated insulin secretion.
22915243 This study identify the PGE(2) EP3 receptor as a novel proinflammatory, proamyloidogenic, and synaptotoxic signaling pathway, and suggest a role for COX-PGE(2) -EP3 signaling in the development of AD.
More...

AA Sequence

MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTGFVGNALAM      1 - 70
LLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVF     71 - 140
GLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFI    141 - 210
STGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTET    211 - 280
AIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLR    281 - 350
KILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER                                  351 - 390
//

Text Mined References (87)

PMID Year Title
26058972 2015 Prostaglandin E2 promotes human cholangiocarcinoma cell proliferation, migration and invasion through the upregulation of ?-catenin expression via EP3-4 receptor.
25333975 2014 Oxidized low-density lipoprotein suppresses expression of prostaglandin E receptor subtype EP3 in human THP-1 macrophages.
24180609 2014 The expression of prostaglandin receptors EP3 and EP4 in human cervix in post-term pregnancy differs between failed and successful labor induction.
23904482 2013 Neuronal prostaglandin E2 receptor subtype EP3 mediates antinociception during inflammation.
23805813 2014 Association of a common genetic factor, PTGER3, with outcome of periodontal therapy and preterm birth.
23493387 2013 Prostaglandin receptor EP3 mediates growth inhibitory effect of aspirin through androgen receptor and contributes to castration resistance in prostate cancer cells.
23406763 2012 EP? receptor-mediated contraction of human pulmonary arteries and inhibition of neurogenic tachycardia in pithed rats.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23364535 2013 Significance of divergent expression of prostaglandin EP4 and EP3 receptors in human prostate cancer.
23349487 2013 Prostaglandin E2 receptor, EP3, is induced in diabetic islets and negatively regulates glucose- and hormone-stimulated insulin secretion.
More...