Property Summary

NCBI Gene PubMed Count 67
Grant Count 11
R01 Count 2
Funding $1,508,576.59
PubMed Score 95.45
PubTator Score 82.80

Knowledge Summary

Patent (2,537)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -5.000 0.000
osteosarcoma 2.668 0.017
Atopic dermatitis -1.500 0.000
lung cancer -1.400 0.001
interstitial cystitis 1.300 0.010
cystic fibrosis and chronic rhinosinusit... -1.592 0.048
invasive ductal carcinoma -1.900 0.003
chronic rhinosinusitis -1.405 0.024
head and neck cancer -1.800 0.031

 GWAS Trait (1)

Gene RIF (50)

PMID Text
26170067 these results indicated that the actions of AKR1C3 can produce FP receptor ligands whose activation results in carcinoma cell survival in breast cancer.
25977569 The results indicated that the rs12731181 G allele of the Prostaglandin F2alpha Receptor Gene was associated with susceptibility to essential hypertension.
25704319 The SNPs of the PTGFR and MMP-1 genes may determine the latanoprost response in a white European Spanish population.
25512374 Angiotensin II type I and prostaglandin F2alpha receptors cooperatively modulate signaling in vascular smooth muscle cells
25339146 Influence of PTGS1, PTGFR, and MRP4 genetic variants on intraocular pressure response to latanoprost in Chinese primary open-angle glaucoma patients
24457363 An association was found between SNPs of the FP receptor gene and the response to latanoprost in patients with glaucoma or OH.
23356224 The F-prostaglandin receptor is a novel marker for tumor endothelial cells in renal cell carcinoma.
22919060 we provide evidence that PGF2alpha induces COX-2 expression via the FP receptor and phosphorylates CREB1 by PKC, thus increasing CREB1 binding to the COX-2 promoter and the expression of COX-2 in human amnion fibroblasts.
22182935 The results of this study suggested that significant novel association signals near the genes PTGFR, and provide supportive evidence for the previously reported association signals near ANK3 and within the 3p21.1 locus.
22060278 we found no indication for an association between SNPs in the prostaglandin F(2alpha) receptor gene or SLCO2A1 and IOP response to prostaglandin analogs in a population of European descent.
More...

AA Sequence

MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQKSKASFLLLA      1 - 70
SGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKP     71 - 140
IFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQASRTWCFYNTEDIKDWEDRFYLLLFSFLGL    141 - 210
LALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSL    211 - 280
ETCETTLFALRMATWNQILDPWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISES    281 - 350
PVAEKSAST                                                                 351 - 359
//

Text Mined References (68)

PMID Year Title
26170067 2015 11?-Prostaglandin F2?, a bioactive metabolite catalyzed by AKR1C3, stimulates prostaglandin F receptor and induces slug expression in breast cancer.
25977569 2015 Rare SNP rs12731181 in the miR-590-3p Target Site of the Prostaglandin F2? Receptor Gene Confers Risk for Essential Hypertension in the Han Chinese Population.
25704319 2015 Association between SNPs of Metalloproteinases and Prostaglandin F2? Receptor Genes and Latanoprost Response in Open-Angle Glaucoma.
25512374 2015 Angiotensin II type I and prostaglandin F2? receptors cooperatively modulate signaling in vascular smooth muscle cells.
25339146 2015 Influence of PTGS1, PTGFR, and MRP4 genetic variants on intraocular pressure response to latanoprost in Chinese primary open-angle glaucoma patients.
24457363 2014 Association between genetic polymorphisms of the prostaglandin F2? receptor gene, and response to latanoprost in patients with glaucoma and ocular hypertension.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23356224 2013 The F-prostaglandin receptor is a novel marker for tumor endothelial cells in renal cell carcinoma.
22919060 2012 Cross talk between PKC and CREB in the induction of COX-2 by PGF2? in human amnion fibroblasts.
More...