Property Summary

NCBI Gene PubMed Count 38
PubMed Score 89.71
PubTator Score 79.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 2.1e-02
astrocytic glioma -1.200 1.1e-02
atypical teratoid / rhabdoid tumor -1.800 1.4e-06
ependymoma -1.300 2.0e-02
facioscapulohumeral dystrophy 3.000 8.5e-06
glioblastoma -1.200 9.8e-04
group 4 medulloblastoma -1.300 1.6e-02
oligodendroglioma -1.300 8.0e-03
osteosarcoma 1.572 2.6e-03
primitive neuroectodermal tumor -1.400 2.7e-02

Gene RIF (23)

AA Sequence

MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY      1 - 70
IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVF     71 - 140
SKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG             141 - 201
//

Text Mined References (39)

PMID Year Title