Property Summary

NCBI Gene PubMed Count 116
Grant Count 245
R01 Count 186
Funding $30,680,418.33
PubMed Score 296.35
PubTator Score 320.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.125 0.006
oligodendroglioma 1.100 0.006
psoriasis -3.000 0.000
osteosarcoma -1.874 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.001
hereditary spastic paraplegia -1.459 0.008
limb girdle muscular dystrophy 2A -1.175 0.001
tuberculosis -1.600 0.000
adult high grade glioma -1.200 0.000
group 4 medulloblastoma 1.500 0.023
subependymal giant cell astrocytoma -3.006 0.017
lung adenocarcinoma -1.300 0.000
Alzheimer's disease -1.300 0.046
Pick disease -1.700 0.000
Breast cancer -1.200 0.000
ovarian cancer 2.500 0.001
Gaucher disease type 1 -1.500 0.012
Down syndrome 1.100 0.015
dermatomyositis -1.500 0.002

Synonym

Accession P43034 B2R7Q7 Q8WZ88 Q8WZ89
Symbols MDS
LIS1
LIS2
MDCR
NudF
PAFAH

Gene

Gene RIF (76)

PMID Text
26380866 In testis: varied levels among samples of different spermatogenic abilities, protein expression restricted to spermatogonia, spermatocytes and spermatids. Also varied levels in unfertilized oocytes, zygotes, cleavage stage embryos and blastocysts.
25479763 Results showed that miR-144 was reduced in cholangiocarcinoma tissues and suggested that miR-144 may be an essential suppresser of cholangiocarcinoma cell proliferation and invasion through targeting LIS1.
24928020 LIS1 and TSNAX genes are not associated with susceptibility to bipolar I disorder in Chinese Han population.
24487275 Identify a key role for Lis1 in hematopoietic stem cells and mark its directed control of asymmetric division as a critical regulator of normal and malignant hematopoietic development
23813913 LIS1 gene duplication is associated with developmental, behavioral and brain abnormalities.
22956769 LIS1 is required for dynein-mediated transport induced by membrane tethering of BICD2-N and LIS1 contributes to dynein accumulation at microtubule plus ends and BICD2-positive cellular structures.
22749159 PAFAH1B1 overexpression contributes to lung tumorigenesis and poor prognosis.
22373868 Studies indicate that binding of dynactin, LIS1 and NudEL regulate cytoplasmic dynein motor activity.
22328561 Studies identified three genes, CHD5, PAFAH1B1, and NME1, strongly associated with patient outcome.
22006948 cell type-restricted role for LIS1 in large vesicular transport and quantitative support for a general role for LIS1 in high-load dynein functions.
More...

AA Sequence

MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELES      1 - 70
KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETG     71 - 140
DFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSA    141 - 210
SRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVE    211 - 280
CISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGG    281 - 350
KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR              351 - 410
//

Text Mined References (121)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26380866 2015 Role of PAFAH1B1 in human spermatogenesis, fertilization and early embryonic development.
25479763 2014 MicroRNA-144 suppresses cholangiocarcinoma cell proliferation and invasion through targeting platelet activating factor acetylhydrolase isoform 1b.
24928020 2014 [Association study of LIS1 and TSNAX genes with bipolar disorder in Chinese Han population].
24487275 2014 Lis1 regulates asymmetric division in hematopoietic stem cells and in leukemia.
23813913 2013 The duplication 17p13.3 phenotype: analysis of 21 families delineates developmental, behavioral and brain abnormalities, and rare variant phenotypes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097494 2012 Human Asunder promotes dynein recruitment and centrosomal tethering to the nucleus at mitotic entry.
22956769 2012 BICD2, dynactin, and LIS1 cooperate in regulating dynein recruitment to cellular structures.
22749159 2012 Overexpression of PAFAH1B1 is associated with tumor metastasis and poor survival in non-small cell lung cancer.
More...